KEGG   Sandaracinus amylolyticus: DB32_000278Help
Entry
DB32_000278       CDS       T03935                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00071  Fatty acid degradation
samy00072  Synthesis and degradation of ketone bodies
samy00280  Valine, leucine and isoleucine degradation
samy00310  Lysine degradation
samy00362  Benzoate degradation
samy00380  Tryptophan metabolism
samy00620  Pyruvate metabolism
samy00630  Glyoxylate and dicarboxylate metabolism
samy00640  Propanoate metabolism
samy00650  Butanoate metabolism
samy00900  Terpenoid backbone biosynthesis
samy01100  Metabolic pathways
samy01110  Biosynthesis of secondary metabolites
samy01120  Microbial metabolism in diverse environments
samy01130  Biosynthesis of antibiotics
samy01200  Carbon metabolism
samy01212  Fatty acid metabolism
samy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DB32_000278
   00630 Glyoxylate and dicarboxylate metabolism
    DB32_000278
   00640 Propanoate metabolism
    DB32_000278
   00650 Butanoate metabolism
    DB32_000278
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DB32_000278
   00072 Synthesis and degradation of ketone bodies
    DB32_000278
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DB32_000278
   00310 Lysine degradation
    DB32_000278
   00380 Tryptophan metabolism
    DB32_000278
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DB32_000278
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DB32_000278
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DB32_000278
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:samy04147]
    DB32_000278
Enzymes [BR:samy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DB32_000278
Exosome [BR:samy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DB32_000278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AKF03129
UniProt: A0A0F6SDB0
Position
330391..331620
Genome map
AA seq 409 aa AA seqDB search
MNSWIIDAVRTPRGRGKAGKGALSGIHPQELFAQVLRALEARGLSAKEVDDVLVGAVSQV
GEQGANVGRNAVLAAGWPIEVTAASVNRFCASGLQTVHFGAMAVASGAQDLVVAGGVESM
SRVPMGADGGGQDGGNQVLRERVFQVPQGISADLIATLEGFSREEIDALALRSQLNAARA
IEEHRFARSIIPVVDPVRGVVVLDRDESPRPDTTLAGLGALPPSFAQLGAAAVGPKGETL
DQIALATQPRADAIRHVHTAGNSSGLADGAAAVVLASDRYVKEHGITPRARIRAMATIGS
DPVLMLTAPAPASQKALRRAGMTTRDIDLWEINEAFSAVVLETTRTLGIDPDRVNVNGGA
IALGHPLGATGAMLLGTVVDELERRDLQTALVTMCIGGGQGIATIVERV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctggatcatcgacgccgtccgcacgccgcgcggtcggggcaaggcgggcaag
ggcgcgctctcgggcatccacccgcaggagctcttcgcgcaggtgctgcgcgcgctcgag
gcgcgtggcctctccgcgaaggaggtcgacgacgtgctcgtcggcgcggtgtcgcaggtc
ggcgagcagggcgcgaacgtcgggcgcaacgcggtcctcgccgcgggctggccgatcgag
gtcacggccgcgtcggtgaaccgcttctgcgcgtcgggtctgcagacggtgcacttcggc
gcgatggcggtcgcgtcgggcgctcaggatctcgtcgtcgcggggggcgtcgagagcatg
tcgcgcgtgccgatgggcgccgacggcggtggccaggacggcggcaaccaggtcctgcgc
gagcgcgtgttccaggtgccgcagggcatcagcgcggatctcatcgcgacgctcgagggc
ttctcgcgcgaggagatcgacgcgctcgcgctccgctcgcagctgaacgccgcgcgcgcg
atcgaggagcaccgcttcgcgcgctcgatcattcccgtggtcgatcccgtgcgcggcgtc
gtcgtgctcgatcgcgacgagagcccgcgtcccgacaccacgctggcggggctcggcgcg
ctgccgccctcgttcgcgcagctcggcgcggcggccgtcggaccgaagggcgagaccctc
gaccagatcgcgctcgcgacgcagccgcgcgccgacgcgatccgtcacgtgcacaccgcg
ggcaactcgagcggcctcgccgacggagcggccgcggtggtgctcgcgtccgatcgctac
gtgaaggagcacggcatcacgccgcgcgcccgcatccgcgcgatggcgacgatcggcagc
gacccggtgctgatgctcaccgcgcccgcgcccgcgagccagaaggcgctgcgccgcgcg
ggcatgacgacgcgcgacatcgacctctgggagatcaacgaggcgttctccgcggtcgtg
ctcgagaccacgcgcacgctcggcatcgatcccgatcgcgtgaacgtgaacggcggtgcg
atcgcgctcggtcacccgctcggcgcgaccggcgcgatgttgctcggcaccgtggtcgac
gagctcgagcggcgcgatctgcagaccgcgctcgtcacgatgtgcatcggcggcggtcag
ggcatcgcgacgatcgtagagcgcgtgtga

DBGET integrated database retrieval system