KEGG   Sandaracinus amylolyticus: DB32_002408Help
Entry
DB32_002408       CDS       T03935                                 

Definition
(GenBank) Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00250  Alanine, aspartate and glutamate metabolism
samy00330  Arginine and proline metabolism
samy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DB32_002408
   00330 Arginine and proline metabolism
    DB32_002408
Enzymes [BR:samy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     DB32_002408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKF05259
UniProt: A0A0F6SEI6
Position
complement(2813390..2815006)
Genome map
AA seq 538 aa AA seqDB search
MSSLPAPYNEHVDTHEPGSPARARLAEALATLSKEVAEIPVVAGPAELRTGSILEVTMPH
RRRHVIARAHEAGAKETQAAIDAALAVAPAWAETPFEERAAIFLRAADLLSGPWRARISA
ACMLGQSKTAHQSEIDAVAEMADFFRWNVHFYAELQKHQPVSPKGMWNRLEMRPLEGFVF
AVTPFNFLAIAANLPCAPILGGNVCVWKPATSSLLGCWHVLEMLREAGLPDGVLTLVPGH
GPTQSEVALASPHLAAIHFTGSTGTFKHLWKGVAANLDRYRTFPRLVGETGGKDFIVAHP
SADPIAVATAISRGGYEYQGQKCSAASRIYVPRSLWPTVRDRVVSDLASMKMGDVADFSN
FVGAVIDDRAFARIRGYQELARQSATILAGGGASDAEGWFVQPTLVQVEDPKHRLMSEEI
FGPVVTCFVYDDAKWSDTLELVDGTSPYALTGAVFARDSIALAEADVALRNAAGNFYVND
KPTGAVVGQQPFGGARASGTNDKAGSMFNLVRWISPRTVKETFVPPTDWRYPFLSDRP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccttcccgcgccctacaacgagcacgtcgacacgcacgagccgggctcgccc
gcacgcgcgcgcctcgccgaagcgctcgcgacgctctcgaaggaggtcgccgagatcccc
gtcgtcgccgggcccgccgagctccgcaccggctcgatcctcgaggtcacgatgccgcac
cgccggcgccacgtgatcgcccgcgcccacgaggccggcgcgaaggagacccaggccgcg
atcgacgccgcgctcgccgtcgcgcccgcgtgggccgagacgcccttcgaggagcgcgcc
gcgatcttcctccgcgccgccgatctcctcagcggcccgtggcgcgcgcgcatcagcgcc
gcgtgcatgctcggccagagcaagaccgcgcaccagtcggagatcgacgccgtcgccgag
atggccgacttcttccggtggaacgtccacttctacgcggagctccagaagcaccagccg
gtctcgccgaagggcatgtggaaccgcctcgagatgcgcccgctcgagggcttcgtcttc
gcggtcacgccgttcaacttcctcgcgatcgccgcgaacctcccgtgcgcgccgatcctc
ggcggcaacgtgtgcgtgtggaagcccgcgacctcgagcctgctcggctgctggcacgtg
ctcgagatgctgcgcgaggcgggcctgcccgacggcgtgctcaccctcgtgcccggccac
ggcccgacgcagagcgaggtcgcgctcgcgagcccgcacctcgccgcgatccacttcacg
ggatcgaccggcaccttcaagcacctgtggaagggcgtcgccgcgaacctcgatcgctac
cgcaccttcccgcgcctcgtcggcgagaccggcggcaaggacttcatcgtcgcgcacccg
agcgcggatccgatcgcggtcgcgaccgcgatctcgcgcggcggctacgagtaccagggc
cagaagtgcagcgccgcgtcgcgcatctacgtcccgcgctcgctgtggccgacggtgcgt
gatcgcgtcgtgtccgacctcgcctcgatgaagatgggcgacgtcgccgacttctcgaac
ttcgtcggcgcggtgatcgacgatcgcgcgttcgcgcgcatccgcggctaccaggagctc
gcgcggcagagcgccacgatcctcgcgggcggcggcgcgagcgacgccgagggttggttc
gtgcagccgacgctggtgcaggtggaggatccgaagcaccgcctgatgagcgaggagatc
ttcggccccgtggtcacgtgcttcgtctacgacgacgcgaagtggagcgacacgctcgag
ctcgtcgatggcacgtcgccctacgcgctcaccggcgccgtgttcgcgcgcgactcgatc
gcgctcgccgaggccgacgtcgcgctgcgcaacgccgcggggaacttctacgtcaacgac
aagccgaccggcgcggtcgtcggccagcagcccttcggcggcgcgcgcgccagcggcacg
aacgacaaggcgggctcgatgttcaacctggtccggtggatcagcccgcgcaccgtgaag
gagacgttcgtcccgccgaccgactggcggtacccgttcctctccgatcgcccctga

DBGET integrated database retrieval system