KEGG   Sandaracinus amylolyticus: DB32_003678Help
Entry
DB32_003678       CDS       T03935                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00020  Citrate cycle (TCA cycle)
samy00480  Glutathione metabolism
samy01100  Metabolic pathways
samy01110  Biosynthesis of secondary metabolites
samy01120  Microbial metabolism in diverse environments
samy01200  Carbon metabolism
samy01210  2-Oxocarboxylic acid metabolism
samy01230  Biosynthesis of amino acids
Module
samy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
samy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DB32_003678
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DB32_003678
Enzymes [BR:samy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DB32_003678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKF06529
UniProt: A0A0F6SF90
Position
4232489..4233745
Genome map
AA seq 418 aa AA seqDB search
MSKDGTLNVPNDPIIPFIEGDGTGRDIWKASVRVFDAAVEKAYGGKRKIVWHEVYAGEKA
FTKFNNWLPDQTIEDFKKYLVGIKGPLTTPIGGGIRSLNVALRQLLDLYVCLRPVRWFEG
VPSPVKRPQDVDMVIFRENTEDIYAGIEFEAGTPENQKFLSLLKEQFPKAYSKIRFPESS
GIGIKPVSKEGTERLVRASIKYAVENKRKSVNLVHKGNIMKFTEGAFRNWGYALAEKEFG
DQVYTWDQWERTKEAKGEDAANAEQKAAIAAGKIVIKDSIADITLQQVLTRPTEFDVIAT
LNLNGDYLSDALAAQVGGIGIAPGGNANYVTGHAIFEATHGTAPKYADKDMVNPSSVILS
GEMMFRHMGWNEVSDLIIKGVEGAITAKTVTYDFARLMEGAKQIKCSEFGDAIIKHMG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggacggcacgctgaacgtcccgaacgacccgatcatcccgttcatcgaaggc
gacggaaccggtcgcgacatctggaaggcgagcgtgcgcgtcttcgacgcggccgtggag
aaggcctacggcggcaagcgcaagatcgtctggcacgaggtctacgcgggcgagaaggcg
ttcacgaagttcaacaactggctgcccgaccagaccatcgaggacttcaagaagtacctc
gtcggcatcaagggcccgctgaccacgccgatcggcggcggcatccgctcgctcaacgtc
gcgctgcgccagctcctcgatctctacgtgtgtctgcgcccggtgcgctggttcgagggc
gtgccctcgccggtgaagcgcccgcaggacgtcgacatggtgatcttccgcgagaacacg
gaggacatctacgccggcatcgagttcgaggcgggcacgccggagaaccagaagttcctc
tcgctcctcaaggagcagttcccgaaggcctactcgaagatccgcttccccgagagcagc
ggcatcggcatcaagccggtctcgaaggaaggcaccgagcgcctcgtgcgcgcctcgatc
aagtacgcggtcgagaacaagcgcaagagcgtcaatctcgtccacaagggcaacatcatg
aagttcacggagggcgccttccggaactggggttacgccctcgcggagaaggaattcggc
gaccaggtctacacctgggaccagtgggagcgcaccaaggaagcgaagggcgaggacgcg
gcgaacgccgagcagaaggcggcgatcgcggcgggcaagatcgtcatcaaggactcgatc
gccgacatcacgctgcagcaggtgctgacgcgtccgaccgagttcgacgtcatcgccacg
ctcaacctgaacggcgactacctgagtgacgcgctcgcggcgcaggtcggcggcatcggc
atcgcgcccggcggcaacgcgaactacgtgacgggccacgcgatcttcgaggcgacgcac
ggcactgcgccgaagtacgccgacaaggacatggtcaatccgtcgagcgtgatcctcagc
ggcgagatgatgttccgccacatgggctggaacgaggtctccgacctgatcatcaagggt
gtcgagggcgccatcacggcgaagacggtcacctacgacttcgcccgtctcatggagggc
gcgaagcagatcaagtgctccgagttcggagacgcgatcatcaagcacatgggctga

DBGET integrated database retrieval system