KEGG   Sandaracinus amylolyticus: DB32_003682Help
Entry
DB32_003682       CDS       T03935                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00230  Purine metabolism
samy00240  Pyrimidine metabolism
samy01100  Metabolic pathways
samy01110  Biosynthesis of secondary metabolites
samy01130  Biosynthesis of antibiotics
Module
samy_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
samy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
samy_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DB32_003682
   00240 Pyrimidine metabolism
    DB32_003682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:samy04131]
    DB32_003682
Enzymes [BR:samy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     DB32_003682
Membrane trafficking [BR:samy04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    DB32_003682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AKF06533
UniProt: A0A0F6W3Q3
Position
4236919..4237335
Genome map
AA seq 138 aa AA seqDB search
MATEKTFAIVKPDAVEKNHIGAILALIEKNGLKIRALRMMHMSRPIAEGFYHVHKARPFF
GELVEFMTRGPCVVMVLEGENAIAKWRELMGATDPAKAAEGTVRKLYGANVGENATHGSD
GPDTAKFEIGWFFPGYDV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgagaagacgttcgcgatcgtgaagcccgacgcggtcgagaagaatcacatc
ggcgcgatcctcgcgctcatcgagaagaacgggctcaagatccgcgcgctgcgcatgatg
cacatgagccgtccgatcgcggagggcttctatcacgtgcacaaggcgcgtccgttcttc
ggcgagctcgtcgagttcatgacgcgcgggccgtgcgtcgtgatggtgctcgagggcgag
aacgcgatcgcgaagtggcgcgagctgatgggcgcgaccgacccggcgaaggccgcggag
ggcacggtgcgcaagctctacggcgcgaacgtcggcgagaacgcgacgcacggctcggac
ggcccggacacggcgaagttcgagatcggctggttcttccccggctacgacgtgtga

DBGET integrated database retrieval system