KEGG   Sandaracinus amylolyticus: DB32_006290
Entry
DB32_006290       CDS       T03935                                 

Definition
(GenBank) Delta(24(24(1)))-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00100  Steroid biosynthesis
samy01100  Metabolic pathways
samy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    DB32_006290
Enzymes [BR:samy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     DB32_006290
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 Steroid_dh
Other DBs
NCBI-ProteinID: AKF09141
UniProt: A0A0F6YKH1
Position
complement(7273456..7274631)
AA seq 391 aa
MHAPLPVSDLGNLLLGAVLALGFVLYLFVGSMIVPGPVRQGVVLSDGSRISYKLNGLALF
LITAGLAAVGTWLGFIDLTLLHRHFWGLFVAANVLSFVMTAQLFASGKDKPGAHRHRADP
TPRITGVDAHGNATGSAAGTQSALGLIEDLWYGVELNPKWMSLDAKMFSYRPSLIGLALL
NMSFAAVQYAKYGELSQAMILYQAFTFVYVFNYFQFEYGMLYTWDIVAERFGFMLVWGDY
AFVPFAYSVTGWYLVDETGDLPPWALVALPLMFVLGLWIFRGSNQQKDEFKRDPSVKIWG
RPAETIGGKILVSGFWGIGRKLNYTGEILVYWSFVLLAWGESFVPFLLPTWLICLLVHRA
WRDDKKCREKYGPLWEQYCKRATFKMIPFVY
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgcacgctcctcttcccgtcagcgatctcggaaatctgctcctcggcgcggtgctcgcg
ctggggttcgtgctgtatctgttcgtcggctcgatgatcgtgccaggaccggtgcgccag
ggcgtcgtgctgtccgacgggagccgcatctcgtacaagctgaacgggctcgcgctcttc
ctgatcacggccgggctggcagcggtcgggacctggctcggcttcatcgatctcacgctg
ctgcatcgccacttctgggggctcttcgtcgccgcgaacgtgctctcgttcgtcatgacg
gcgcagctcttcgcgagcggcaaggacaagcccggcgcacaccgtcaccgcgccgatccc
accccgcgcatcaccggcgtcgacgcgcacggcaacgcgaccgggagcgcggcgggcacg
cagagcgcgctcgggctgatcgaggacctctggtacggcgtggagctcaatccgaagtgg
atgagcctcgacgcgaagatgttcagctatcgcccgtcgctgatcggactggcgctcttg
aacatgtcgttcgccgcggtgcagtacgcgaagtacggcgagctctcgcaggcgatgatc
ctctatcaggcgttcacgttcgtgtacgtcttcaactacttccagttcgagtacggaatg
ctctacacgtgggacatcgtggccgagcgtttcggcttcatgctcgtgtggggtgactac
gcattcgtgcccttcgcgtactcggtcacgggctggtacctcgtcgacgagaccggtgat
ctcccgccctgggcgctggtcgcactgccgctgatgttcgtgctcgggctctggatcttc
cgcggatcgaaccagcagaaggacgagttcaagcgcgatccgagcgtgaagatctggggt
cgtcccgcggagacgatcggcgggaagatcctggtctccggcttctgggggatcggccgc
aagctgaactacacgggcgagatcctcgtctattggtcgttcgtgctgctggcgtggggc
gagtcgttcgtcccgttcctgttgcccacctggctcatctgtctgctcgtccaccgcgcg
tggcgagacgacaagaagtgtcgcgagaagtacggccctctgtgggagcagtactgcaag
cgcgcgaccttcaagatgattcccttcgtgtattga

DBGET integrated database retrieval system