KEGG   Sandaracinus amylolyticus: DB32_006294Help
Entry
DB32_006294       CDS       T03935                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
K23557  3beta-hydroxysteroid-4beta-carboxylate 3-dehydrogenase (decarboxylating) [EC:1.1.1.417]
Organism
samy  Sandaracinus amylolyticus
Pathway
samy00900  Terpenoid backbone biosynthesis
samy01110  Biosynthesis of secondary metabolites
samy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:samy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DB32_006294
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DB32_006294
Enzymes [BR:samy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     DB32_006294
    1.1.1.417  3beta-hydroxysteroid-4beta-carboxylate 3-dehydrogenase (decarboxylating)
     DB32_006294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 NAD_binding_4 NmrA RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: AKF09145
UniProt: A0A0F6YMD8
Position
complement(7280430..7283057)
Genome map
AA seq 875 aa AA seqDB search
MTSELSGFYRLSMRDRRARVAQVIGAREDELASLSPDRGLAEGQADRMVENALGVLGMPL
GLCVNMRIALDGEPARDVLAPMAVEEPSVIAAASYASKLLRAGGGVRATVSEPVMIGQIQ
VLEVPDPEVAERAVLAAKDELIASANSGHPSLTAAGGGARDVEIRHLARLGEDDPCGAMM
VVHLVVDVRDAMGANAINTMCERLAPRVAELTGGRVALRILSNLTDRRTVTVEGRVPFSA
LEGQGASSGEALARAIEEASVFAERCPWRAATHNKGIMNGVDAVLIALGQDWRAVEAGAH
AYAAQDGRYTAMARWRAEDGALVGRMTLPMAVGTVGGVIRVHPQVQVNRRIAKIERAPEL
AAIVAAAGLAQNLGALRALAAEGIQSGHMRLHARNVAVEAGATGSEVEQVANTIADRREV
NLRAAKEALATLRARPIAKVEPIAITTPTTTRPARRPPTPPMPESARASMSSGESTSGES
SMTSSDSGTQKRYERQPHREFGGKVFVTGAAGHLGANLVRRLLAEGRDVRVLLRQGSNNE
ALEGLQIEKVYGDLRDAKRLVELMRGCTTAYHAAAQVSTVVATPELERDIFECNVLGTRN
LLRAAIDNHYERVVVTGSFSAVGYDPENPQRPGNEDDVFYPFDDVLPYARTKVQVEHEVL
KACVEGLDAVIATSCAILGPHDYKPSRMGLTLVDYANGRLRAYPPGGFDFVAARDICEGH
FLAMHRGRRGQKYIISTQFATVDDLMDIFEEVSGRPRPRLRIPGPVMQGIAAVSQVALDT
FAPSTPRRFTPAAIRILRAQRHADTTKAQVELGYEPTSIRTAIHEAYADFARRGLVPARP
GTVGVAESAARKSPPARATTDSAASESSNRAATGS
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcgagctctcggggttctatcggctctcgatgcgggatcgccgcgcgcgcgtc
gcgcaggtgatcggggcgcgcgaggacgagctcgcgtcgctctcgccggatcgcggcctc
gccgaggggcaggcggatcgcatggtcgagaacgcgctcggcgtgctcgggatgccgctc
ggcctctgcgtgaacatgcgcatcgcgctcgacggcgagccggcgcgcgacgtgctcgcg
ccgatggcggtcgaggagccgagcgtgatcgccgccgcgagctacgcgtcgaagctgctg
cgcgccggcggcggcgtgcgggcgaccgtgagcgagcccgtgatgatcgggcagatccag
gtgctggaggtgccggatccggaggtcgccgagcgtgccgtgctcgccgcgaaggacgag
ctgatcgcgagcgcgaactccggtcatccctcgctgaccgccgcgggcggcggcgcgcgc
gacgtcgagatccgacacctcgcgcgcctcggcgaggacgatccgtgcggcgcgatgatg
gtcgtgcacctcgtcgtcgacgtgcgcgacgcgatgggcgcgaacgcgatcaacacgatg
tgcgagcgcctcgcgccgcgcgtcgccgagctcaccgggggccgcgtcgcgctgcgcatc
ctctcgaacctcaccgatcggcgcaccgtgaccgtcgaaggtcgcgtgccgttctccgcg
ctcgaagggcagggcgcctcgagcggcgaagcgctggcgcgcgccatcgaagaggcgagc
gtgttcgccgagcgctgcccgtggcgcgccgcgacgcacaacaaggggatcatgaacggc
gtcgatgccgtcctgatcgccctcgggcaggactggcgcgcggtcgaggccggcgcgcac
gcgtacgccgcgcaggacggccgctacaccgcgatggcgcgctggcgtgcggaggacggc
gcgctggtcggtcgcatgacgctgccgatggcggtcggtacggtcggcggcgtgatccgc
gtgcacccgcaggtgcaggtcaaccgccgcatcgcgaagatcgagcgcgcgccggagctc
gcggcgatcgtcgcggcggcgggcctcgcgcagaacctcggcgcgctgcgcgcgctcgcg
gccgagggcatccagagcggtcacatgcgcctgcacgcgcgcaacgtcgcggtcgaagcc
ggcgcgacgggcagcgaggtcgagcaggtcgcgaacacgatcgccgatcgccgcgaggtg
aacctgcgcgccgcgaaggaagcgctcgcgaccttgcgcgcgcggccgatcgcgaaggtc
gagccgatcgcgatcacgacacccacgacgacgcgcccggcgcgccgcccgccgacgcct
ccgatgccggagagcgcgcgagcgtcgatgtcgagcggagagagcacgagcggggagagc
agcatgacgagcagcgattcgggcacgcagaagcgttacgagcgacagccgcaccgcgag
ttcggcggcaaggtcttcgtcaccggcgccgcggggcacctcggcgcgaacctggtgcgc
cgcctgctggccgagggccgcgacgtgcgcgtgctgctccgtcagggcagcaacaacgag
gcgctcgagggcctgcagatcgagaaggtctacggcgatctccgcgacgccaagcgcctc
gtcgagctgatgcgcggctgcacgaccgcgtatcacgcggcggcgcaggtctcgacggtc
gtcgcgacgcccgagctcgagcgcgacatcttcgagtgcaacgtcctcggcacgcggaac
ctgctgcgcgccgcgatcgacaaccactacgagcgcgtcgtcgtcaccgggtcgttcagc
gcggtcggctacgaccccgagaacccgcagcgccccgggaacgaagacgacgtcttctat
cccttcgatgacgtgctgccctatgcgcgcacgaaggtgcaggtcgagcacgaggtgctg
aaggcgtgcgtcgagggcctcgacgcggtgatcgcgacgtcgtgcgcgatcctcgggccc
cacgactacaagccttcgcgcatgggcctgacgctcgtcgactatgcgaacggccgactg
cgcgcgtatccgccgggcgggttcgacttcgtcgcagcgcgcgacatctgcgaggggcat
ttcctcgcgatgcaccgcggtcggcgcggccagaagtacatcatcagcacgcagttcgcg
acggtcgacgacctcatggacatcttcgaggaagtgtccggtcgtccgcgcccgcgcctg
cgcatcccgggcccggtgatgcagggcatcgcggcggtctcccaggtcgcgctcgacacg
ttcgcgccgagcacgccgcgccgcttcacgccggctgcgattcgcatcctccgcgcgcag
cgccacgcggacaccacgaaggcgcaggtcgagctcggctacgagccgacgagcatccgc
accgcgatccacgaggcgtacgcggacttcgcgcgtcgtgggctcgtccccgcgcgcccc
ggcaccgtcggtgtcgcggagagcgcagcgcgcaagtcgcccccggcccgcgcgacgacg
gactccgcagcatcggagtcgtcgaatcgcgccgcgaccggcagctga

DBGET integrated database retrieval system