KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1772
Entry
gbs1772           CDS       T00104                                 

Name
(GenBank) Unknown
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00620  Pyruvate metabolism
san00640  Propanoate metabolism
san00650  Butanoate metabolism
san01100  Metabolic pathways
san01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:san00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    gbs1772
   00640 Propanoate metabolism
    gbs1772
   00650 Butanoate metabolism
    gbs1772
Enzymes [BR:san01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     gbs1772
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: CAD47431
UniProt: Q8E3I7
Position
1831800..1834112
AA seq 770 aa
MATVKTNTDIFEQAWEGFKGVDWKEKASIARFVQANYAPYDGDESFLAGATERSLHIKKV
IEETKAHYEETRFPMDTRVASISELPAGFIDKDSELIFGIQNDELFKLNFMPKGGIRMAE
TTLKENGYEPDPAVHEIFTKYATTVNDGIFRAYTSNIRRARHAHTVTGLPDAYSRGRIIG
VYARLAVYGADYLMQEKVNDWNALNDIDEESIRLREEINLQYQALGEVVKLGDLYGVDVR
KPAMNTKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLDIFAERDLARGTFTESEIQEFV
DDFVLKLRTVKFARTKAYDALYSGDPTFITTSMAGMGADGRHRVTKMDYRFLNTLDNIGN
SPEPNLTVLWSDQLPYAFRRYCMSMSHKHSSIQYEGVSTMAKEGYGEMSCISCCVSPLDP
ENEDKRHNLQYFGARVNVMKALLTGLNGGYDDVHKDYKVFDIDPIRDEVLNFDTVKANFE
KSLDWLTDTYVDAMNIIHYMTDKYNYEAVQMAFLPSHVRANMGFGICGFANTVDSLSAIK
YATVKPIRDEDGYIYDYETVGDFPRYGEDDDRVDSIAEWLLEAFHGRLAKHKLYKDAEAT
VSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSVNLSKVEFFSPGANPSNKAKGGWLQNLN
SLSKLDFAHANDGISLTTQVSPRALGKTFDEQVDNLVTVLDGYFENGGQHVNLNVMDLKD
VYDKIMNGEDVIVRISGYCVNTKYLTPEQKTELTQRVFHEVLSMDDALTN
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcaacagttaaaacaaacacagatatctttgaacaagcttgggaaggctttaaaggt
gttgattggaaagaaaaagcaagtattgctcgcttcgttcaagcaaactatgcaccttac
gatggagatgaaagcttcttagctggagcaactgaacgttcacttcacatcaaaaaagtg
attgaagaaacaaaagctcactatgaagaaactcgcttcccaatggatactcgtgttgct
tcaatttctgaattaccagctggttttatcgacaaagatagcgaactcatctttggtatt
caaaacgacgagcttttcaaattgaacttcatgcctaaaggtggtatccgtatggcggaa
actacacttaaagaaaatggttatgaacctgatccagctgttcacgaaatcttcactaag
tacgctacaacagtaaatgatggtatcttccgcgcttatacttctaacattcgtcgtgct
cgccatgcacacactgttactggtcttccagacgcttattcacgcggacgtatcattggt
gtatatgctcgtctagctgtttacggtgctgactacttgatgcaagaaaaagttaatgac
tggaatgcattgaatgatattgatgaagagtcaattcgtcttcgtgaagaaatcaacctt
caataccaagctcttggtgaagttgtaaaacttggtgacctttacggcgtagatgttcgt
aaaccagccatgaacactaaagaagccattcaatgggtgaacattgctttcatggctgta
tgtcgtgttatcaatggtgctgcaacatcacttggacgtgttcctattgtccttgatatc
tttgcagaacgtgacctcgctcgcggtacattcacagaatcagaaatccaagaatttgtt
gatgattttgtccttaaactccgtactgtaaaatttgctcgtactaaagcttatgatgcc
ctttactcaggtgacccaacctttatcacaacttcaatggcaggtatgggagctgatgga
cgtcatcgtgttaccaaaatggactatcgtttcttaaatacacttgacaatatcggtaac
tcaccagaaccaaacttaactgttctttggtcagaccaattaccatatgctttccgtcgc
tactgtatgtcaatgagtcataaacactcttcaatccaatatgaaggtgtatcaacaatg
gctaaagaaggctacggtgaaatgtcatgtatttcatgttgtgtatctccacttgatcca
gaaaacgaagacaaacgtcacaaccttcaatattttggtgctcgtgttaacgttatgaaa
gcacttcttactggtcttaacggtggttatgatgatgttcataaagattacaaagtattt
gacatcgacccaattcgtgacgaagtactcaactttgacactgtaaaagctaactttgaa
aaatctcttgactggttgactgatacttatgttgatgcgatgaatatcatccactacatg
actgataaatacaactatgaagctgtacaaatggcattcttaccttcacatgtacgtgct
aatatgggatttggtatctgtggttttgcaaatactgtcgattcattatctgcgattaaa
tacgctactgttaaaccaatccgtgacgaagatggttacatctacgactacgaaacagtt
ggtgacttcccacgttatggtgaagatgatgatcgtgttgactcaatcgctgaatggtta
cttgaagccttccatggacgccttgctaaacacaaactttataaagatgctgaagcaact
gtttctcttcttacaatcacatcaaacgttgcttactctaaacaaactggtaactcaccg
gtacataaaggagtatatctcaatgaagatggtagtgtaaacctttctaaagtagaattc
ttctcaccaggcgctaacccttctaacaaagctaaaggtggctggttacaaaacttgaat
tcactttctaaacttgatttcgctcatgcaaatgatggtatttcattgacaactcaagtt
tctccacgcgctcttggtaaaacatttgatgaacaagttgataacttggtaacagtcctt
gatggttactttgaaaacggtggtcaacacgttaacttgaatgtcatggaccttaaagat
gtctatgacaagattatgaatggtgaagatgttatcgttcgtatctcaggttactgtgtc
aatactaaatatctaactcctgagcaaaaaactgagttaacacaacgtgtcttccatgaa
gtactttcaatggacgatgcattaactaactag

DBGET integrated database retrieval system