KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs0857Help
Entry
gbs0857           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00730  Thiamine metabolism
san01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:san00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    gbs0857
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:san03000]
    gbs0857
Enzymes [BR:san01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     gbs0857
Transcription factors [BR:san03000]
 Prokaryotic type
  Other transcription factors
   Others
    gbs0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: CAD46501
UniProt: Q8E5X2
Position
882657..883313
Genome map
AA seq 218 aa AA seqDB search
MLKDEMIAKGAKYIQSIYQDPFIQGIIKGRLDHDVICHYLQADNIYLGKFADIYALCLAK
SDNLRDKQFFLEQIDFTLNRELADGEGPHQALAAYTNRSYQDIIEKGVWYPSADHYIKHM
YFHFYENGIAGALAAMSPCPWIYHQLAKKIIEENQFLNGNPFNNWITFYANDTVEELMEN
YFRMMDYYAQNLSKEKQADLVDAFVKSCQMRDVFFKWQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagatgagatgattgctaaaggagcaaaatatatccaatccatctatcaagat
ccatttattcaaggaattataaaagggcgtttagaccatgacgtaatctgccattattta
caggcagataatatctaccttgggaaatttgctgatatttatgccctgtgcttggcaaaa
tctgataatttacgagataaacaatttttccttgaacaaattgactttacattaaatcgg
gagttagcagatggtgaaggcccacatcaagccttagccgcttatactaatcgatcttat
caggatattatcgaaaagggtgtatggtacccgtcagcagatcattacattaaacatatg
tattttcatttttacgaaaatggtattgctggtgctttagctgcaatgagcccatgtcca
tggatttaccatcaattggctaaaaaaataattgaggagaaccagtttttgaatggtaac
ccttttaataattggataactttttatgctaacgatacagttgaagagttaatggaaaac
tattttcgtatgatggattattatgcgcagaatttgtcaaaagagaagcaagctgatttg
gtagatgcttttgtgaaatcttgtcagatgagagacgtttttttcaaatggcaataa

DBGET integrated database retrieval system