KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1144Help
Entry
gbs1144           CDS       T00104                                 

Definition
(GenBank) unknown
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: CAD46803
UniProt: Q8E588
Position
complement(1190476..1191186)
Genome map
AA seq 236 aa AA seqDB search
MNKRKLLTVLSIASVAVLSSVTFADEITPSDPTAPSTPLITPTPVDPGTPTDTTKPSTPV
DPGTPTDTTKPSTPVDPGTPTDTTKPSTPVDSGTSTNPSDSEATNTNLGTKPTDVVKPET
PKIPEVPSTVTPDVIDKVDKETGNITIKPIQISPDKTIIGTQNGNVIIRDSSGSHLVSAS
EVGGRLNEDGTVTIKDSSGKTKTLPRTGEAKGFLSIIGATILSFVAYLFKQRVTLN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagaaaattattaacagtcttatcaattgcatcagttgcagttttatcaagt
gttacttttgcagatgaaataactccatctgatccaacagcaccatcaacaccccttatt
actccaaccccagtagatcctggaacaccaactgatacgacaaaacctagtactccagta
gatcctggaacgccaactgatacgacaaaacctagtactccagtagatcctggaacacca
actgatacgacaaaacctagtactccagtagattcagggacttcgactaatccctcagat
tcagaagcaacaaatacaaatctaggtacaaaaccaacagatgtagttaagccagagaca
cctaaaatccctgaagtgccgtcaacagtaactccagatgtgattgacaaggtagacaaa
gaaacaggtaatattacgattaaaccaattcaaatcagccctgataaaacgattattgga
acacaaaatggtaatgtcattattcgagatagttcaggcagccacttagtatctgcaagt
gaagttggtggtcgacttaatgaagatgggacagtaacaattaaagattcgtcagggaaa
acaaaaacactccctcgtactggagaagctaaaggattcttaagcattattggtgccaca
atcctatcttttgtagcttatttattcaagcagagagtaactttaaattaa

DBGET integrated database retrieval system