KEGG   Streptococcus agalactiae NEM316 (serotype III): gbs1769Help
Entry
gbs1769           CDS       T00104                                 

Definition
(GenBank) Unknown
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:san00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    gbs1769
Enzymes [BR:san01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     gbs1769
DNA repair and recombination proteins [BR:san03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     gbs1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 PIF1 AAA_12 AAA_22 T2SSE Herpes_Helicase UvrD_C DUF2075 5_3_exonuc UvrD-helicase AAA RsgA_GTPase HHH_3 Helicase_RecD AAA_18 AAA_28 NTPase_1 AAA_17 TsaE cobW AAA_29 NACHT
Motif
Other DBs
NCBI-ProteinID: CAD47428
UniProt: Q8E3J0
Position
1827434..1829854
Genome map
AA seq 806 aa AA seqDB search
MEVFFTGTIERIIFENASNFFKILLLEIEDTDSDFDDVEVIITGTMADVIEGEEYTFWGT
LTQHPKYGEQLQSVRYERAKPTSGGLVKYFSSEQFKGIGKKTAQRIVELYGDNTIDKILE
SPEQLSTISGLSKINREAFIAKLKLNYGTEQVLAKLAEYGLSNRAAIQIFDHYKEESLEV
INENPYQLVEDIQGIGFKIADQLAEQVGIESDSPKRFRAAIIHTLVESSMEQGDTYIEAR
TLLEKTITLLEEVRQIELDPSIVAKELTNLIAEDKVQHIGTKIFSNTLFFAEEGIKKNLQ
RILNQPLDKQLSHKDIDREIRDIQKSLNIHYDNIQEKAIREALLSKVFILTGGPGTGKTT
VINGIIEAYSELHHIDLNKNDIPIVLAAPTGRAARRMNELTGLPSATIHRHLGLNGDSDY
QSLDDYLDCSLIIIDEFSMVDTWLANQLFDALDSHTQVIIVGDSDQLPSVGPGQVLADLL
NINALPHIKLEKIFRQSEESTIVTLANQMRQGFLPEDFTAKKADRSYFEASANIIPNMIS
KIVQSALKSGIEAHEIQILAPMYRGQAGINNLNLIMQNLLNPLKDNNQFTFNDINFRIGD
KVLHLVNDTELNVFNGDIGYITDLIPAKYTESKQDEIYMTFDGQEVIYQRKEWLKITLAY
AMSIHKSQGSEFQVVILPITRQSGRMLQRNLIYTAITRSKSKLILLGEIGAFDFAVKNEG
AKRNTYLIERFENKQEIANSQKIEDSSIDQKIDNTIINTSIPKTATPIEQTNLSKITYRL
TEENYLTIDPMIGINQQDISAIFDSK
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattttttacaggaaccattgaacgcattatatttgaaaatgccagcaatttt
tttaaaatattacttctggaaatcgaagatacggatagcgattttgatgatgtagaagta
attattactggtactatggccgacgttatagagggagaagaatatactttttggggaaca
ctaacccaacatccaaaatacggcgagcaactacaaagtgtacgctatgaaagagccaag
cctacttcaggtggccttgtgaaatacttttctagcgaacaatttaaaggaattggtaaa
aagactgcccaacgcatcgtagaactctatggagataataccattgataaaatccttgaa
tcccctgaacagttaagtacaatctcaggactatcaaaaattaatagagaagcattcatc
gctaaactgaaactcaattatggaacagagcaagttttagctaaactcgctgaatatggg
ttaagcaatcgtgctgctattcaaatatttgatcactataaagaagaatcacttgaagtg
ataaacgaaaatccttatcaacttgttgaggatatccaaggtatcggttttaaaatagct
gaccaacttgctgaacaagtcggtattgaaagtgattctcctaaacgctttcgtgctgct
attattcatactttagttgagtcttctatggagcaaggagatacctatattgaggctcgt
actctcttggaaaaaaccattactctccttgaagaagttcgtcaaatcgaactagatcct
tcaattgttgctaaggaattgacaaatttaattgcagaagataaagtgcaacatattgga
actaaaatttttagtaatactctattttttgccgaagaaggcatcaaaaaaaacttacaa
cgaatactaaatcagcctcttgataaacaactaagtcacaaagatattgaccgtgaaatc
agagatattcaaaaatctttaaatatccactacgataatatccaagaaaaagctattaga
gaagctttactaagtaaggtatttatcttgactggtggcccaggaacaggtaaaacaaca
gttataaatggtattattgaagcctattccgagttacatcatattgatttaaacaaaaat
gatattcctattgtacttgctgctcctacaggtcgtgctgctagacgcatgaatgaactt
accggtttaccgagtgctactattcataggcatttgggattaaacggagatagtgactat
caaagtctagatgactatctagattgttccttaattatcattgatgaattttcaatggtt
gacacttggcttgctaatcaattatttgacgctttggactcgcacacacaagttattatt
gtcggagatagtgatcaattaccgtctgtaggtccaggacaagttctagcagatctttta
aatataaatgcacttccacacattaaacttgaaaagatttttagacaatcagaagaatca
actattgtgactttagctaatcaaatgagacagggctttttgccagaggactttacagct
aaaaaagccgatcgctcatactttgaagcatctgctaatatcatcccaaatatgatttct
aaaattgttcaatctgcacttaagagcggtattgaagctcatgaaattcaaattttagct
cctatgtatcgcggccaagcaggtattaataatcttaaccttatcatgcaaaatctcctc
aatccattaaaagataataaccaatttacttttaatgatataaatttccgaataggagat
aaagtgttacatttagtcaacgatacagagcttaatgtttttaatggggatattggttac
ataacggaccttataccagctaaatatactgagagcaagcaagatgagatttatatgact
tttgatggtcaagaagttatctaccaacgcaaagaatggcttaaaataacactagcctat
gctatgagtattcataaatcacagggttctgaatttcaagttgttattctgccaataacg
agacagagtggtcgaatgttacagcgaaaccttatttatacagctattacgagatctaaa
agtaaactaatacttttaggagaaattggtgcatttgatttcgctgttaaaaacgagggg
gcaaagcgcaatacttatctgatagaaagatttgaaaacaagcaagaaatagctaattct
caaaaaattgaagatagctcaatagatcaaaagattgacaacacaataattaatacgtcc
attccaaaaacagcaacaccaattgagcagactaatctttcaaaaataacttatcgccta
actgaagaaaattatttaacaatcgatccaatgattggtattaatcaacaagatataagt
gcaatttttgatagtaaataa

DBGET integrated database retrieval system