KEGG   Streptococcus agalactiae NEM316 (serotype III): ndkHelp
Entry
ndk               CDS       T00104                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Pathway
san00230  Purine metabolism
san00240  Pyrimidine metabolism
san01100  Metabolic pathways
san01110  Biosynthesis of secondary metabolites
Module
san_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
san_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
san_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:san00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ndk
   00240 Pyrimidine metabolism
    ndk
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:san04131]
    ndk
Enzymes [BR:san01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     ndk
Membrane trafficking [BR:san04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    ndk
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CAD46575
UniProt: Q8E5R4
Position
953424..953840
Genome map
AA seq 138 aa AA seqDB search
MEQTFFMIKPDGVKRGFIGEVISRIERRGFSIDRLEVRHADADILKRHYAELTDRPFFPT
LVDYMTSGPVIIEVISGEEVISTWRTMMGSTNPKDALPGTIRGDFAQAPSPNQATCNIVH
GSDSPESATREIAIWFNN
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaccttttttatgataaaacctgatggtgtaaaacgtggttttattggagaa
gttattagtcgtattgagcgtcgaggcttctctattgatcgcttagaggttagacatgca
gatgcagatattttgaaaagacattatgcagaactgacggatagaccattctttccaacg
ttagtagattatatgactagtggtccagtaatcattgaagttatttcgggagaagaggtc
atttcaacttggcgcaccatgatggggagtactaaccccaaagatgcccttccaggaact
attcgaggagattttgcacaagctccctctccaaatcaagcgacatgtaatattgttcat
gggtcagactcacctgaatctgcaactcgcgagatagccatttggttcaataactaa

DBGET integrated database retrieval system