KEGG   Streptococcus agalactiae NEM316 (serotype III): sodHelp
Entry
sod               CDS       T00104                                 

Definition
(GenBank) manganese-dependent superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
san  Streptococcus agalactiae NEM316 (serotype III)
Brite
Enzymes [BR:san01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     sod
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAD46452
UniProt: P0A4J3
Position
830854..831462
Genome map
AA seq 202 aa AA seqDB search
MAIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
SQIPEDIRQAVINNGGGHLNHALFWELMSPEETQISQELSEDINATFGSFEDFKAAFTAA
ATGRFGSGWAWLVVNAEGKLEVLSTANQDTPIMEGKKPILGLDVWEHAYYLNYRNVRPNY
IKAFFEIINWNKVNELYQAAKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagatttaccctatgcatatgatgcgcttgagccacatattgat
gctgagacaatgacactacatcatgataagcaccatgcaacttatgttgctaatgcaaat
gctgctcttgagaaacatcctgaaattggagaagacttagaggcgctcttagctgatgtt
tctcaaattccagaagatattcgtcaggcagtcatcaataacggtggtggacatcttaac
cacgctcttttctgggaattgatgtcaccagaagaaactcaaatttcacaagagttatct
gaagacattaatgcaacttttggttcatttgaagactttaaagctgctttcacagcagca
gcaacaggacgttttggttcaggttgggcttggcttgttgttaatgctgaaggcaaactt
gaagtgctttcaactgccaatcaagatactccaattatggaaggcaagaaacctatttta
gggcttgatgtatgggagcatgcttattacttaaactatcgtaatgttcgtcctaactac
atcaaagctttctttgaaattattaactggaataaagtaaatgaactttaccaagctgct
aaagcttaa

DBGET integrated database retrieval system