KEGG   Streptococcus anginosus C238: SANR_0337Help
Entry
SANR_0337         CDS       T02829                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc00520  Amino sugar and nucleotide sugar metabolism
sanc01100  Metabolic pathways
sanc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SANR_0337 (nagA)
Enzymes [BR:sanc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SANR_0337 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGU82824
Position
325871..327022
Genome map
AA seq 383 aa AA seqDB search
MPKYIQADQFFYPHGIRQGGYLELVNGKFGKWFKEIPADAEVIDHTGYSIAPGLVDTHIH
GFGGVDVMDNNIEGTLHTMSEGLLSTGVTSFLPTTLTSTFELLLAVTENIGAHYQEATGA
KIRGLYFEGPYFTEKYKGAQNPTYMKDPRMDEFLAWQKASNGLLNKIALAPEREGVEDFV
RTITDEGVTVALGHSNATFEEAKAAVDAGASVWVHAYNGMRGLTHRELGMVGAMYELPHT
YAELICDGHHVDPKACDILMKQKGHENVALITDCMTAGGLEDGDYMLGEFPVVVANGTAR
LKSTGNLAGSILKLKDGLKNVVKWGIANPHEAVMMATLNPAKSVHIEDVCGQIKEGHDAD
FIVLDKDLELVATYLDGEKRYEV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatacattcaagcagatcaatttttctatcctcatggtattcgtcaaggtggc
tatctggaattagtcaatggcaaatttggaaaatggttcaaagaaattccagcagatgcg
gaagtgatagatcacacaggttattctattgcaccaggcttggtagatactcatattcat
ggctttggtggtgttgatgtgatggacaataatatcgaagggacgcttcacaccatgagt
gaaggactgctgtcaacaggtgtcaccagttttttgccaacaaccttgacctcaactttt
gaattgttgctagctgtgaccgaaaatattggtgctcattatcaagaagcgacaggtgct
aagattcgtgggctttattttgaaggaccgtatttcacagaaaaatacaagggcgctcaa
aatccaacttatatgaaagaccctcgaatggatgaatttctcgcttggcaaaaagcttca
aatggtttgctcaataaaatcgctctagcgccagaacgagaaggtgttgaagactttgtc
cgcaccattacggatgagggcgtaacggttgcgttgggacactcaaatgcaacttttgaa
gaagcaaaagcagctgtggatgcgggtgctagtgtctgggttcatgcttataatggaatg
cgtggattgacccaccgagaactcggcatggtcggagctatgtacgagctgcctcatact
tatgcggaattgatttgtgacggtcaccatgttgatccaaaagcctgtgatattttgatg
aagcaaaaaggacatgaaaatgtagcacttatcacagattgtatgactgcaggtggcttg
gaagacggagactatatgctgggagaatttccagtagtggtcgccaacggaactgctcgt
ctcaaatcaacaggcaacctcgcgggctctatcttgaaattgaaagacggactgaagaac
gttgtcaaatggggcattgccaacccacatgaagcagttatgatggcaacgctcaatcca
gcaaaatccgttcatattgaggatgtttgcggtcaaatcaaagaaggtcacgatgcggac
tttatcgttttggacaaggatttagaactcgttgcaacttatcttgatggtgaaaaacga
tacgaagtgtaa

DBGET integrated database retrieval system