KEGG   Streptococcus anginosus C238: SANR_1045Help
Entry
SANR_1045         CDS       T02829                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc00071  Fatty acid degradation
sanc00072  Synthesis and degradation of ketone bodies
sanc00280  Valine, leucine and isoleucine degradation
sanc00310  Lysine degradation
sanc00362  Benzoate degradation
sanc00380  Tryptophan metabolism
sanc00620  Pyruvate metabolism
sanc00630  Glyoxylate and dicarboxylate metabolism
sanc00640  Propanoate metabolism
sanc00650  Butanoate metabolism
sanc00900  Terpenoid backbone biosynthesis
sanc01100  Metabolic pathways
sanc01110  Biosynthesis of secondary metabolites
sanc01120  Microbial metabolism in diverse environments
sanc01130  Biosynthesis of antibiotics
sanc01200  Carbon metabolism
sanc01212  Fatty acid metabolism
sanc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SANR_1045
   00630 Glyoxylate and dicarboxylate metabolism
    SANR_1045
   00640 Propanoate metabolism
    SANR_1045
   00650 Butanoate metabolism
    SANR_1045
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SANR_1045
   00072 Synthesis and degradation of ketone bodies
    SANR_1045
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SANR_1045
   00310 Lysine degradation
    SANR_1045
   00380 Tryptophan metabolism
    SANR_1045
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SANR_1045
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SANR_1045
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SANR_1045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanc04147]
    SANR_1045
Enzymes [BR:sanc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SANR_1045
Exosome [BR:sanc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SANR_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: AGU83505
Position
complement(1075879..1077057)
Genome map
AA seq 392 aa AA seqDB search
MKEAVIVSAVRTPLGSFGGSLKNISAVDLGSLVIKSALERANLKAEQVDEVIMGNVLGAG
LGQNVARQMSVNAGIPVSSPAFTVNKVCGSGLKTVQLAAQAILCGDADIIVAGGAENMSQ
APYVLQNQRWGSRMGDSKVVDTMLRDGLTDAFNDFHMGITAENVAAQYDISREVQDAFAV
QSQQRAVAAIEAGRFKEEIVPVIIPQRKCEPIVFDTDEFPRKDASLEGLAKLRPVFKEGG
TVTAGNASGINDGAAAVVVMSSEKAKELGIPVLATIKSYASAGLDPKIMGCGPIYASRKA
LEKGGFTTEDLDLIESNEAFASQACAVGKELNLDPEKVNVNGGAIALGHPIGASGCRILV
TLLHEMEKRDAKRGLATLCIGGGMGTAVIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagttattgtatcagcagttcgtacaccattaggttcttttggtggaagt
ttgaaaaatatttcagctgttgatttgggaagtttggttatcaaaagcgcgctggaacga
gcaaatttgaaggctgaacaagttgatgaagtgattatgggaaatgttttaggggcagga
cttggtcagaatgtggcacgccaaatgagtgtcaatgcaggtatccctgtatcttctcca
gcattcacagtcaataaagtatgtggttcagggcttaaaactgttcagttggctgcacaa
gctatcctttgtggagatgctgatatcatcgtagcgggtggtgcagaaaatatgagccaa
gcaccatatgtgctgcaaaatcaacgttggggctctcgtatgggagactctaaagttgtt
gatactatgttgcgcgacggtctgactgacgcctttaatgatttccacatgggaatcaca
gctgaaaatgttgctgcacagtatgatatttctcgtgaagtccaagatgcttttgctgtt
cagtcacaacaacgtgctgtggcagctattgaagctggacgtttcaaagaagaaatcgtt
ccagtgattattccacagagaaaatgtgagccaattgtttttgatacggatgaatttcca
agaaaagatgcctcactagaaggtttggctaaattacgccctgtctttaaagaaggcgga
acggtcacagctggtaatgcttctggtatcaacgatggagcggcagcagttgttgtcatg
agttcagaaaaagcgaaagagctaggcattcctgttttagcaaccataaaatcctatgca
agtgcaggattagatccgaaaatcatgggttgcggaccaatttatgcttctcgtaaagca
cttgaaaagggtggctttacaactgaagatctcgatttgattgaatccaatgaagcattt
gcatcgcaagcatgtgctgttggtaaggagttaaatcttgatccggaaaaagtaaacgta
aacggtggtgccattgcacttggtcatccaattggagcatcaggctgccgtattctggtt
actttgttgcatgaaatggaaaaacgcgatgctaaacgtggtcttgcaactctttgtatc
ggaggaggaatgggcacagcagttattgtagaacgttaa

DBGET integrated database retrieval system