KEGG   Streptococcus anginosus C238: SANR_1216Help
Entry
SANR_1216         CDS       T02829                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc00670  One carbon pool by folate
sanc01100  Metabolic pathways
sanc01120  Microbial metabolism in diverse environments
sanc01200  Carbon metabolism
Module
sanc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SANR_1216 (fhs)
Enzymes [BR:sanc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SANR_1216 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719 T3SchapCesA
Motif
Other DBs
NCBI-ProteinID: AGU83663
Position
complement(1258203..1259873)
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIAQSVDLQPIADVVKKVGIDYDDLELYGKYKAKLSFNKIQELQKNPVGKLILVT
AINPTPAGEGKSTITIGLADALNKIGKKTMIAIREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALIDNHLHQGNALGIDQRRIIWKRVVDLNDRALRHVTVG
LGSPVNGIPREDGFDITVASEIMAILCLATSIEDLKERLANIVIGYRYDRTPVYVRDLEV
EGALALILKDAIKPNLVQTIYGTPAFVHGGSFANIAHGCNSVLATTTALHLADYTVTEAG
FGADLGAEKFLDIKTPNLPTAPDVVVIVATLRALKMNGGVVKEDLTTENVEAVKAGFANL
KRHVGNIRKFGVPVVVAINEFVTDTQAEIAVLKELCAEIDVPVELASVWADGADGGLALA
EVVVKTIETRPAKYTRLYDNNLSIEEKIEKIVKEIYRGTKVNFEKKAKTQISQIVKNGWD
KLPICMAKTQYSFSDNPNLLGAPENFEITIREVVPKLGAGFIVALTGDVMTMPGLPKRPA
ALNMDVAADGTAIGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggatatagaaattgctcagagtgttgacttgcagccgattgctgatgtagtg
aagaaagttggaattgattacgatgatttggagctttacggtaaatacaaggctaaattg
tcttttaataagattcaggaattgcaaaagaacccagttggtaagctgattctggtaaca
gcaatcaatccaacaccggctggcgaagggaaatcgactattactattggtttagcggat
gctctcaataaaatcggcaagaaaaccatgattgctattcgtgaaccatctcttggacca
gttatgggaatcaagggtggagccgctggaggtggttatgcacaggttctaccaatggaa
gacatcaatttgcatttcacaggagatatgcatgcgattaccactgccaacaatgccctt
tctgctttgattgataatcatttacatcaaggaaatgctctaggaattgaccaacgtcgc
attatctggaagcgcgtggtagatctgaatgaccgtgctttgcggcatgtgaccgtcggt
ctgggcagtccggttaatggaattccgcgggaagatggttttgatattacggttgcatct
gaaatcatggctattctctgtttagcgacaagtattgaagacttgaaagaacgtctagct
aatatcgttattggttatcgttatgatcggacgcctgtttatgttcgagatttggaagta
gaaggggctcttgctctcatcttgaaagacgctataaagcccaatctagtacagactatt
tatggaacccctgcctttgttcacggtggatcgtttgccaatattgctcacggctgtaat
tccgttttggcaacgacaacagctttgcatttggcggactacacggtgactgaagctggc
ttcggtgcggatctaggggctgaaaaattcctagacatcaaaacgcccaatctgccgact
gctccagatgtagtggttattgttgcaactcttagagcattgaaaatgaacggtggtgtc
gttaaagaagatctgacaactgagaatgttgaagcggttaaagcaggttttgccaacctc
aaacgccatgtgggaaatatccgtaaatttggtgttccggtcgtggtggctatcaatgaa
tttgtgacggacacccaagctgaaattgccgttctcaaggaactttgtgcagagattgat
gtcccggtggaattggctagtgtctgggcagatggtgctgacggtggattggctcttgcg
gaagttgtggtcaaaacgattgaaacgagacctgccaaatacactcgactctatgacaac
aatctgtctatcgaagaaaaaatcgagaaaattgtcaaggaaatctatcgtggaacaaaa
gtcaattttgaaaagaaagcaaaaactcaaatttctcaaattgtcaagaacggctgggat
aagctgccaatttgtatggccaagacccagtacagtttttcagataatccaaatcttcta
ggagcgccagaaaactttgaaatcactatccgcgaagtagttccaaaattgggtgcaggt
tttattgtcgccctaactggtgatgttatgacgatgcccggtctgccaaaacgcccagca
gccctcaatatggacgtagcagcagacggaactgctattggactattttaa

DBGET integrated database retrieval system