KEGG   Streptococcus anginosus C238: SANR_1974Help
Entry
SANR_1974         CDS       T02829                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sanc  Streptococcus anginosus C238
Pathway
sanc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sanc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SANR_1974 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sanc03011]
    SANR_1974 (rplV)
Ribosome [BR:sanc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SANR_1974 (rplV)
  Bacteria
    SANR_1974 (rplV)
  Archaea
    SANR_1974 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGU84367
Position
complement(2081089..2081433)
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKSRLVLDNIRGKDVADAIAILKFTPNKAAGIIEKVLNSAIA
NAENNFGLEKANLVVSEAYANEGPTMKRFRPRAKGSASPINKRTSHITVVVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtgcgcgtttcacctcgtaaa
tctcgtctagttcttgacaatatccgcgggaaagacgtcgctgacgcaatcgcaatcttg
aaattcacaccaaacaaagctgctggcattatcgaaaaagtgttgaactcagcaatcgct
aatgcagaaaacaactttggtttggaaaaagcaaacttggtagtatctgaagcttacgca
aacgaaggaccaacaatgaaacgtttccgtccacgcgcaaaaggttcagcttcaccaatc
aacaaacgcactagccacatcacagtggtcgttgcagaaaaataa

DBGET integrated database retrieval system