KEGG   Streptococcus anginosus C1051: SAIN_0782Help
Entry
SAIN_0782         CDS       T02828                                 

Definition
(GenBank) putative hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00627  Aminobenzoate degradation
sang01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sang00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAIN_0782
Enzymes [BR:sang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SAIN_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AGU81531
Position
817435..818208
Genome map
AA seq 257 aa AA seqDB search
MTYKGYLIDLDGTIYRGKDRIPAGEDFVHELQRRNIPYLFVTNNTTRTPETVQTMLAEQF
NVETPIETIYTATLATVDYLNDKNLGKKVYVIGDVGLKQAIAEAGYVEDTDNPDYVVVGL
DWEVDYEKLSIATLAIQKGAHFVGTNPDLNIPTERGLMPGAGSIITLIEVATRVKPVYIG
KPNAIIMEKAVEHLGLPRQEVIMVGDNYLTDIRAGIDNGIPTLLVTTGFTKPEEVPGLPI
QPDYVLSSLAEWDFDAH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaaaggatatttaattgatttagacggaacgatttatagaggaaaagaccgt
attcctgcgggtgaagattttgttcacgaactacaacggcgcaacattccatatttattt
gtgacgaacaatacaacacgtactcctgagactgttcaaacgatgctagcggaacaattc
aatgttgaaacgccgattgaaacgatttatacagcgactttagcaaccgttgactactta
aatgataaaaatttaggcaagaaagtctacgttatcggtgatgtaggacttaagcaagcc
attgcagaagctggttatgttgaagatacggataatccagattatgtagtcgtgggattg
gattgggaagtggactatgaaaaattgtcaattgctacgttagctattcaaaagggagct
catttcgtaggaaccaatccagatcttaatattccaacggagcgcggtctcatgcctgga
gcaggatcgattattactctcattgaagtagcaactcgtgtgaaacctgtttatatcggg
aagccaaatgcaattatcatggaaaaggcggttgagcatctaggactaccgcggcaagaa
gtgataatggttggggataattacctgacggacattcgggctgggattgacaatggtatc
cctacgcttctggtgacaactggctttacgaaaccagaagaagtgccaggcttgccaatc
caaccagattatgtactttctagcctagcggagtgggatttcgatgcgcattaa

DBGET integrated database retrieval system