KEGG   Streptococcus anginosus C1051: SAIN_0948Help
Entry
SAIN_0948         CDS       T02828                                 

Gene name
acoL
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00010  Glycolysis / Gluconeogenesis
sang00020  Citrate cycle (TCA cycle)
sang00260  Glycine, serine and threonine metabolism
sang00280  Valine, leucine and isoleucine degradation
sang00310  Lysine degradation
sang00380  Tryptophan metabolism
sang00620  Pyruvate metabolism
sang00630  Glyoxylate and dicarboxylate metabolism
sang00640  Propanoate metabolism
sang01100  Metabolic pathways
sang01110  Biosynthesis of secondary metabolites
sang01120  Microbial metabolism in diverse environments
sang01130  Biosynthesis of antibiotics
sang01200  Carbon metabolism
Module
sang_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAIN_0948 (acoL)
   00020 Citrate cycle (TCA cycle)
    SAIN_0948 (acoL)
   00620 Pyruvate metabolism
    SAIN_0948 (acoL)
   00630 Glyoxylate and dicarboxylate metabolism
    SAIN_0948 (acoL)
   00640 Propanoate metabolism
    SAIN_0948 (acoL)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAIN_0948 (acoL)
   00280 Valine, leucine and isoleucine degradation
    SAIN_0948 (acoL)
   00310 Lysine degradation
    SAIN_0948 (acoL)
   00380 Tryptophan metabolism
    SAIN_0948 (acoL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sang04147]
    SAIN_0948 (acoL)
Enzymes [BR:sang01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SAIN_0948 (acoL)
Exosome [BR:sang04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SAIN_0948 (acoL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Biotin_lipoyl Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 FAD_binding_3 DAO Trp_halogenase NAD_binding_7 AlaDh_PNT_C Biotin_lipoyl_2 Thi4 3HCDH_N HlyD_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGU81692
Position
complement(991811..993514)
Genome map
AA seq 567 aa AA seqDB search
MTLEVIMPKAGVDMTEGQIVQWNKKVGEFVKEGEILLEIMTDKVSMELEAEEDGYLIAIL
KGDGETVPVTEVIGYLGEEGENIPTTVAVSDASSTPTATTTSNDDNKSDDAYDIVVIGGG
PAGYVAAIKAAQLGGKIALVEKSELGGTCLNRGCIPTKTYLHNAEIIESLDHAANRGIII
ENPSFTVNMDKVLETKNKVVNTLVGGVAGLLRSYDVDVHKGIGTITKDKNVLVNGSELLE
TKKIILAGGSKVSKINVPGIESPLVMTSDDILDMKEVPESLVIIGGGVVGIELGQAFMTF
GSKVTVVEMMNRIVPAMDAEVSKNLRLILERKGMTILTETKLEEIIEENGKLRIKVAGKE
DIIADKALLSIGRVPDLEGIGEVDFELDRGRIKVNEYMETSVSGIYAPGDINGTKMLAHA
AFRMGEVAAENALKGNHVVAKLNLTPAAIYTLPEVAAVGLTEEQAREKYDVAIGKFNFAA
NGRAIASDAAQGFVKVIADKKYGEVLGVHIIGPAAAELINEASTIIEMEITVEEMLKTIH
GHPTFSEVMYEAFADVLGMAIHAPKKR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagaagtaattatgccaaaagccggcgttgatatgacagaaggacagattgtt
caatggaataaaaaagttggcgaatttgtaaaagaaggagaaatccttctggaaatcatg
acagataaagtcagcatggagttagaagcagaggaagatggctatctgattgctatcttg
aaaggagacggtgagactgttcctgtaacggaagttatcggttatctgggcgaagaagga
gaaaatattccgactactgtggctgtttcagatgctagttcaacaccaactgcaaccaca
acttctaacgacgataataagagtgatgacgcttatgatattgtggttattggtggcgga
ccagctggctatgtggcagcgattaaagcagctcaattaggaggcaagattgcccttgtt
gaaaaatctgaactaggtggaacctgcctcaaccgtggctgtatcccgactaagacctat
cttcacaatgcagaaattattgaaagcctagaccatgcagcaaaccgcggaattatcatt
gaaaatccaagctttaccgtcaatatggataaagttctggaaaccaaaaacaaggttgtc
aacacacttgtcggaggtgttgcaggtctgcttcgcagctatgatgttgatgttcacaaa
ggaattggtaccattaccaaagataagaatgtcttagtgaacggttctgaacttcttgaa
accaagaaaattatcttagctggtggctcaaaagtcagcaagattaacgttccaggcata
gaatcaccacttgttatgactagcgatgatattctagatatgaaggaagttccagaaagt
ttagtaatcattggtggtggcgttgttggtattgagctaggacaggctttcatgaccttt
ggcagtaaggtgacggttgtcgaaatgatgaatcggattgttccagctatggatgcagaa
gtctctaagaacctacggctcattcttgaacgcaagggcatgaccattttgacagagacc
aagttggaagaaattatcgaagaaaatggcaagctccgcatcaaagttgcaggaaaagaa
gatatcatagctgataaagctttgctttctattggacgcgtacctgatttggagggaatt
ggcgaggttgactttgaactagaccgtggtcgcatcaaggtcaatgaatatatggaaact
tctgtttcaggaatttacgcacccggagacattaacggtaccaagatgttggcgcatgca
gcttttcgtatgggagaagtagctgcagagaatgctctcaaaggcaatcatgtagttgct
aaattaaatctaactccagcagccatctacactttaccagaagttgcggcagtcggtctg
acagaagaacaagctcgcgaaaaatacgatgtagctatcggcaaattcaactttgcagca
aacggacgagcaattgcatctgatgctgctcaaggatttgtcaaagtgattgctgataag
aaatacggagaagttctcggtgttcacattatcggccctgcagcagctgagttaatcaat
gaagcttctactatcatcgaaatggaaatcacggtggaagaaatgctcaaaaccattcac
ggtcatccgacattctcagaagttatgtacgaagcatttgcagacgtactcggcatggct
attcatgctccaaagaaaagataa

DBGET integrated database retrieval system