KEGG   Streptococcus anginosus C1051: SAIN_0969Help
Entry
SAIN_0969         CDS       T02828                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sang  Streptococcus anginosus C1051
Pathway
sang00071  Fatty acid degradation
sang00072  Synthesis and degradation of ketone bodies
sang00280  Valine, leucine and isoleucine degradation
sang00310  Lysine degradation
sang00362  Benzoate degradation
sang00380  Tryptophan metabolism
sang00620  Pyruvate metabolism
sang00630  Glyoxylate and dicarboxylate metabolism
sang00640  Propanoate metabolism
sang00650  Butanoate metabolism
sang00900  Terpenoid backbone biosynthesis
sang01100  Metabolic pathways
sang01110  Biosynthesis of secondary metabolites
sang01120  Microbial metabolism in diverse environments
sang01130  Biosynthesis of antibiotics
sang01200  Carbon metabolism
sang01212  Fatty acid metabolism
sang02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAIN_0969
   00630 Glyoxylate and dicarboxylate metabolism
    SAIN_0969
   00640 Propanoate metabolism
    SAIN_0969
   00650 Butanoate metabolism
    SAIN_0969
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAIN_0969
   00072 Synthesis and degradation of ketone bodies
    SAIN_0969
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAIN_0969
   00310 Lysine degradation
    SAIN_0969
   00380 Tryptophan metabolism
    SAIN_0969
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAIN_0969
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAIN_0969
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAIN_0969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sang04147]
    SAIN_0969
Enzymes [BR:sang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAIN_0969
Exosome [BR:sang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAIN_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C SpoVAD ZoocinA_TRD
Motif
Other DBs
NCBI-ProteinID: AGU81713
Position
complement(1014245..1015423)
Genome map
AA seq 392 aa AA seqDB search
MKEAVIVSAVRTPLGSFGGSLKNISAVDLGSLVIKSALERANLKAEQVDEVIMGNVLGAG
LGQNVARQMSVNAGIPVSSPAFTVNKVCGSGLKTVQLAAQAILCGDADIIVAGGAENMSQ
APYVLQNQRWGSRMGDSKVVDTMLRDGLTDAFNDFHMGITAENVAAQYGISREVQDAFAV
QSQQRAVAAIEAGRFKEEIVPVIIPQRKGEPIVFDTDEFPRKDASLEGLAKLRPVFKEGG
TVTAGNASGINDGAAAVVVMSSEKAKELGIPVLATIKSYASAGLDPKIMGCGPIYASRKA
LEKGGFTVEDLDLIESNEAFAAQACAVGKELNFDPEKVNVNGGAIALGHPIGASGCRILV
TLLHEMEKRDAKRGLATLCIGGGMGTAVIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagttattgtatcagcagttcgtacaccattaggttcttttggtggaagt
ttgaaaaatatttcagctgttgatttgggaagtttggttatcaaaagcgcgctggaacga
gcaaatttgaaggctgaacaagttgatgaagtgattatgggaaatgttttaggggcagga
cttggtcagaatgtggcacgtcaaatgagtgtcaatgcaggtatccctgtatcttctcca
gcattcacagtcaataaagtatgtggttcagggcttaaaactgttcagttggctgcacaa
gctatcctttgtggagatgctgatatcatcgtagcgggtggtgcagaaaatatgagccaa
gcaccatatgtgctgcaaaatcaacgttggggctctcgtatgggagactctaaagttgtt
gatactatgttgcgcgacggtctgactgacgcctttaatgatttccacatgggaatcaca
gctgaaaatgttgctgcacagtatggtatttctcgtgaagttcaagatgcttttgctgtg
caatctcaacaacgtgccgtggcagctattgaagctggacgtttcaaagaagaaatcgtt
ccagtgattattccacagagaaaaggtgagccaattgtttttgatacggatgaatttcca
agaaaagatgcctcgttagaaggtttggctaaattgcgtcctgtctttaaagaaggtgga
actgtcacggctggtaatgcttctggtatcaatgacggagcagcagcagttgttgtcatg
agttcagaaaaagcaaaagagctaggcattcctgttttagcaaccataaaatcctatgca
agtgcaggattagatccgaaaatcatgggttgcggaccaatttatgcttctcgtaaggca
cttgaaaaaggtggttttacagttgaagaccttgatttgattgaatccaatgaagccttt
gcagctcaagcgtgtgctgtcggaaaagagctgaattttgacccagaaaaagtaaacgtc
aatggcggagccattgcacttggtcatccaattggagcatcaggctgccgtattctggtt
actttgttgcatgaaatggaaaaacgcgatgctaaacgtggtcttgcaactctttgtatc
ggaggaggaatgggcacagcagtcattgtagaacgttaa

DBGET integrated database retrieval system