KEGG   Sinocyclocheilus anshuiensis: 107653177
Entry
107653177         CDS       T04917                                 

Definition
(RefSeq) retinol dehydrogenase 7-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107653177
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     107653177
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR DMP12
Other DBs
NCBI-GeneID: 107653177
NCBI-ProteinID: XP_016295325
UniProt: A0A671LDS8
Position
Unknown
AA seq 328 aa
MYEYLSNNCTCTYVLGVFVLLWVLVWFYRDNLEITKVLEKHVFVTGCDSGFGHLLCKRLN
KRGFRVLAGCLTEKGADDLKRATGPFLKTCILDVTSTASIQKALEWTKKEVGDKGLWGLV
NNAGRSLPMGPSEWMKIKDFESTLKVNMTGVIEMTMNFFPLVKKARGRVVNVASVLGRVA
ANGGGYCISKFAVESFSDCLRRDIQNFGVNVCIIEPGFFKTQVTSLEPIERELHRLWNQL
TPEVKESYGDKYLDKYIKIQRLIMNTICDSDLSKVTNCMEHALLAVHPRTRYSAGWDAKL
LWIPLSYMPACIVDIALKLVLPKPAKSV
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtacgagtacttgagtaataactgtacatgcacatacgtcttgggtgtgttcgtgctg
ctgtgggttctggtgtggttctaccgggacaacctggagatcaccaaggtcttggagaaa
catgtttttgtgacgggttgtgactctgggttcggacacctactgtgcaaacgtctgaac
aaacgtggtttccgtgtcctagccgggtgtctcacggaaaagggtgcagatgatttgaag
agggcgacgggacctttcctgaagacctgcatcttggacgtgaccagcacagccagcatt
cagaaggctttggaatggaccaaaaaagaagttggagataaaggactatggggactcgtg
aacaacgccggacgctcccttcccatgggtccatcagagtggatgaaaatcaaagacttc
gaaagcacgctcaaagtcaacatgactggtgttatcgagatgaccatgaacttctttcct
cttgtcaaaaaagcccgtggacgagtggtgaacgtggcatcagtgttgggaagagtggca
gctaacggcggagggtattgcatctcaaagtttgcggtggagagcttctctgattgtctc
aggagggacatccagaattttggggtcaatgtgtgcatcatagaacctggtttcttcaag
acacaggtgaccagcctggagcctatcgagagggaacttcatcgcctctggaaccaactg
acgcctgaagtgaaggagagttatggagacaaatacttggataaatatatcaagatccag
aggctgatcatgaacaccatatgcgactccgacctcagtaaagtgaccaactgcatggaa
cacgccctgctggccgtccacccaaggacacgctacagtgcaggctgggatgccaagctc
ttgtggattcccttgtcttatatgcccgcttgcattgtagatattgccctaaagctggtg
ttgccaaagccagcaaaaagtgtctag

DBGET integrated database retrieval system