KEGG   Sinocyclocheilus anshuiensis: 107654154Help
Entry
107654154         CDS       T04917                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107654154
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sanh04812]
    107654154
   04147 Exosome [BR:sanh04147]
    107654154
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    107654154
Cytoskeleton proteins [BR:sanh04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     107654154
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107654154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Ras AAA_16 FeoB_N Gtr1_RagA AAA_22 ABC_tran AAA_29 Roc Fez1
Motif
Other DBs
NCBI-GeneID: 107654154
NCBI-ProteinID: XP_016296587
Position
Unknown
AA seq 433 aa AA seqDB search
MIERPDSAVSSVAQRNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSL
FLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPV
INYIDSKFEDFLNAESRVNRRLMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVI
PLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDDEDSKLIRKIKEKMPLAVVG
SNVVIEVNGRKVRGRQYPWGVAEEGIIVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHY
ENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVK
EKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFQEEKANWEAQQRILEQQKLDAS
KTMEKNKKKGKIF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagagacccgactcagctgtttccagcgttgcacagaggaatctggagggttat
gtcggcttcgccaacctccccaaccaggtgtacaggaagtccgtgaagagggggtttgag
ttcacactcatggttgtcggtgagtctggactgggcaaatccacgcttatcaattccctc
tttctgacagacctgtactccaaagactaccctggcccatctcaaaggatcaagaagact
gttcaggtggaacagtccaaagtgctgataaaggaggggggcgtccagctcacgctgacc
atcgtcgacacaccaggctttggagatgcggtggacaacagcaactgctggcaacccgtc
atcaactacatcgacagtaagtttgaagacttcctcaatgctgaatcccgggtaaacagg
aggctgatgcctgacaacagggtgcactgctgcttgtacttcatcgccccctctggtcac
ggactgaaacctcttgatattgagtttatgaagcgtcttcatgacaaagtcaacgttatc
ccactcatcgccaaggccgatactctcacgccagaggagtgccagctgttcaagaaacag
atcatgaaggagatccaggagcacaaaatcaagatctacgagtttcccgacacagaggat
gatgaggacagcaaactgatccgaaagataaaggagaagatgcctctggccgtggtcggt
agcaacgtggtgatcgaagtaaatggcaggaaggtcagagggcgtcagtacccctggggt
gtggcagaagagggcattattgtggagaacggtgagcactgtgacttcacggttctgagg
aatatgctcatcaggactcacatgcaggacctgaaggacgtgaccaataatgttcactat
gaaaactaccggagtaagaaactagcagccgtcacctgcaacggggtcgacgccaccaag
aacaagggccagctcacaaagagtcccctggcccagatggaggaggagaggagggagcat
gtgatgaagatgaagaagatggagaccgagatggagcaggtctttgagatgaaggtcaaa
gaaaagaagcaaaaactgaaggactctgaggcagagttggagaggcgtcacgaacagatg
aagaagaatctagaagctcagtataaagagcttgaggagaagaggcgccagtttcaggag
gaaaaagccaactgggaggcccagcaacgcatcctggagcagcagaaacttgatgcatca
aagacaatggaaaagaacaagaaaaaaggaaaaatcttttaa

DBGET integrated database retrieval system