KEGG   Sinocyclocheilus anshuiensis: 107654864Help
Entry
107654864         CDS       T04917                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00970  Aminoacyl-tRNA biosynthesis
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107654864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sanh03029]
    107654864
Enzymes [BR:sanh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     107654864
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     107654864
Mitochondrial biogenesis [BR:sanh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107654864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase NB-ARC
Motif
Other DBs
NCBI-GeneID: 107654864
NCBI-ProteinID: XP_016297637
Position
Unknown
AA seq 534 aa AA seqDB search
MSASSAAFRPAAAMLGLSIREVSQALRDGRVSATELCKKCIDQIQRTHYLNAFITITGET
AMEQAQKADNRICTGKPLGPLDGIPFSVKDNFCTENIETTCASNMLKGYVPPFSATVVQK
LLDQGAVLVGKTNLDEFAMGAGSTDGVFGPVRNPWSYTTLYREQSTEDPDSDWAIAGGSS
GGSAAAVASLSSFLALGSDTGGSTRNPGSLCGVVALKPTYGLLSRHGLIPLVNSMDVPGI
MTRSVHDAATVLRILQGPDERDSTTVQAPSTPPSLPEHFDIRDICVGIPKEYHAPGLSTD
TLAQWSRVAAMFEQAGARVQEVSLPHTQHSIVCYHVLCCCEVASNMARFDGLEYGHCSTV
DSSTDAMYTTTRHEGFNNVVRRRILSGNYFLLKSNYERYFVKAQQMRRLIAEDFKNVFRS
GIDVLLTPTTLSDAARYADFIQEDNRTRSAQEDVFTQPVNMAGLPAVTVPTALSCRGLPI
SLQLIGQTLQDWKLLTVAHWMEQQVNFPLIPLHGDSNERKLDRSVRERTHTIGS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcctccagtgcggcgtttcgtccggcggcagcgatgctcggtctgtccattaga
gaggtgtcccaggcactgagggatgggagggtgtccgccactgagctctgcaaaaagtgc
atcgaccaaatacaaagaacacattacctgaatgcatttatcaccattacaggggagacg
gctatggagcaagcacagaaagcagacaacaggatctgcacaggtaaacctcttggtcct
ctggatggcattcccttctctgtgaaagacaacttctgcacggagaacatagagaccacc
tgtgcttcaaacatgcttaaaggttatgttcctccattcagtgctacagttgtgcagaag
ctgttggatcaaggagcagttcttgttggaaaaactaatttagatgagtttgcaatggga
gctggaagtacagatggggtgtttggtccagttcgtaacccatggagctacacaacccta
taccgtgagcagagcacagaagatccagattctgactgggcaattgcaggaggaagttca
ggaggtagtgctgcagcagtggcatctctcagcagcttcctagccttgggatctgataca
ggaggctctacacgaaaccctggttctctctgtggggttgtggctctgaaacccacttac
ggcctgctctctcgtcacggactcatccctctggtcaactcaatggatgtgccaggaatc
atgactaggagtgtccatgatgctgccactgtcttgaggattctgcagggcccagatgag
agagactcaacaactgtccaggcacccagcaccccacctagccttcctgaacactttgac
attagagacatatgtgttggtataccaaaggaatatcacgccccgggcctgtctacagac
actctggcccagtggagtcgagttgcagccatgtttgagcaggcaggggcgcgggtacag
gaagtatctctgccacacacacagcactctattgtctgttaccacgtcctgtgttgctgt
gaggttgcatccaacatggcacgttttgatgggcttgaatacggccattgtagtacagtc
gacagctccacagatgccatgtacaccaccacacgacatgaaggcttcaacaatgtggtt
cgcagaagaattctgtcaggaaactacttcctactgaaatcaaactatgagcgttacttt
gtgaaggctcaacaaatgcggcgtcttatcgctgaagattttaaaaatgtgttccgctct
ggcattgacgttctcctgacacccacaacgctgagcgatgcggcgcgctacgctgacttc
atacaggaagacaaccgaacgcgcagtgctcaggaggatgtcttcacccagcctgtcaac
atggcaggtttgcctgctgtcacggtaccaacagccctctcatgccgaggtcttcccatc
agcctgcagctgattggtcagacactacaggactggaagctgttgacagtagcccactgg
atggaacaacaagtcaactttccattgatccctttgcatggagactcaaatgagagaaag
ctggaccgatcagtcagagaaaggacacacacaataggatcataa

DBGET integrated database retrieval system