KEGG   Sinocyclocheilus anshuiensis: 107656016Help
Entry
107656016         CDS       T04917                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04218  Cellular senescence
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107656016
   04370 VEGF signaling pathway
    107656016
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107656016
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107656016
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107656016
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107656016
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   107656016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 107656016
NCBI-ProteinID: XP_016299152
Position
Unknown
AA seq 392 aa AA seqDB search
MLTNANSPPKFPNQHQQQQQQQQQQQQQQQNTAQFMMGKASLQIKKNAITDDYKVTSQVL
GLGINGRVLEIFHKRSGEKYALKMLHDCPKARREVELHWRASSCTHIVRIIDVYENLYQN
RKCLLIVMECMDGGELFSRIQDRGDQAFTEREASDIMKSIGEAIQYLHAINIAHRDVKPE
NLLYTSKRPNALLKLTDFGFAKETTSHNSLATPCYTPYYVAPEVLGPEKYDKCCDMWSLG
VIMYILLCGYPPFYSNHGLAISPGMKKRIRMGQYEFPNPEWSEVSEEAKQLIRTLLKTEP
TQRMTITEFMNHPWINQSMEVPQTPLHTSRVLKEEKDAWEDVKEEMTSALATMRVDYEQI
KIKRIEDSSNPLLMKRRKKTNNTAAENETPAC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttgactaacgccaacagtccgccgaagtttccaaaccagcaccagcagcagcaacaa
caacaacagcagcagcagcagcagcaacagaatacagcccaattcatgatgggaaaagcc
tcacttcagatcaagaaaaatgccataactgacgactacaaggtcactagccaggtcctg
gggctgggcatcaatggcagggttctggagatctttcacaagaggagtggggagaagtat
gctttaaagatgcttcatgactgtcccaaagctagacgagaggtggagctgcactggcgg
gcatcctcatgtacccatatcgtcaggattattgacgtctatgagaatctctaccaaaac
aggaagtgccttcttattgtaatggagtgcatggatggtggtgagctgttcagtcggatt
caggacagaggggaccaggcatttactgagagagaggcttctgatatcatgaagagtata
ggagaggccattcagtatttacatgcaataaacatcgcacaccgagacgtcaagccagag
aacctcttatatacctctaaaaggcccaacgcccttctcaaactgacagactttgggttt
gcaaaagagacaacctcacacaactctctggccaccccttgctatactccttattatgtt
gccccagaggttcttggtccagaaaagtatgacaagtgctgtgacatgtggtctttgggt
gtcatcatgtatattctgctttgtggttacccacctttctattccaaccacggattggct
atatcccctggtatgaaaaaacgaatccgcatggggcagtatgagtttccaaatcctgaa
tggtcggaagtttcagaggaagccaagcagctcatcagaacattactgaaaactgagccg
acacaaaggatgaccatcacagagtttatgaaccacccctggatcaatcaatcaatggag
gtgccacagacgcccctacacaccagccgtgttctgaaagaagagaaagacgcatgggag
gatgtcaaggaagaaatgactagtgccttggcaacaatgagagtcgactatgagcagatc
aaaatcaagaggattgaagactcgtccaatccactgctgatgaagaggagaaagaaaacc
aacaatacagctgctgaaaacgagacgcccgcttgctaa

DBGET integrated database retrieval system