KEGG   Sinocyclocheilus anshuiensis: 107657179Help
Entry
107657179         CDS       T04917                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107657179
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sanh04030]
    107657179
G protein-coupled receptors [BR:sanh04030]
 Rhodopsin family
  Lipid
   Leukotriene
    107657179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Serpentine_r_xa 7tm_4
Motif
Other DBs
NCBI-GeneID: 107657179
NCBI-ProteinID: XP_016300689
Position
Unknown
AA seq 387 aa AA seqDB search
MATLVPTKPSALSGPAQTSIAPASPSTASLPLSHQIGIAILVIAFVFGFPGNLFVVWSVL
CRVRRRSVTCLLILNLAVADALVLLSAPLFLRYLIGRRGWEFGAALCKTVHYLCCVNMYA
SIYLICLMSMDRWLAVTKPFLSQRLRTKKRLLSVMLGIWVMAFLMALPMPFYRSVLPVST
NVSIYLCKPYHWESNAHEAFQYLTETILGFLLPFSFILFRYISVIRRLRSAMFQRKGRGN
ALILLIIAAFTIFWLPYHLINILQVIGLMQGSSSSILTAAIVARPNVTAFTFLSSSVNPV
LYVFAGSSHIRQAGLGFMAKLFEGTNSESASTRSSRGSNAESSVFTKLSVKLSRKGDGAR
AETPGGEDENTADVHNRDEMKTLTTLH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccactcttgttcctacgaagccctcagccctatctggaccagctcagacctccatc
gcgcccgcctccccttccacagcatccctgcccctgtcccatcagatcggcattgctatc
ctggtcatcgccttcgtgtttggttttcccgggaacctgttcgtggtgtggtcggttctg
tgtcgagtgcgtcggcgctccgtcacgtgtctgctgatcctgaatctggccgtggcggac
gcgctggttctcctgagcgctccgctgttcctccggtacctgataggaaggagaggctgg
gagtttggagccgccctgtgtaagacggtccattacctgtgctgcgtcaacatgtacgcc
tccatctacctgatctgcctgatgagcatggaccgctggctggctgtcacaaagccgttt
ctgtctcagaggttgaggactaagaaaaggctcctgtccgtcatgttggggatctgggtg
atggcttttctgatggctttgcccatgccgttctatcgttctgtgttgccagtctctacg
aatgtgtccatctacctgtgtaagccgtaccactgggagagcaacgctcatgaagccttt
cagtacctgactgagactattctgggtttcctgctgcccttcagcttcatcctgttccgc
tacatctcagtgatccgtcggctgcgtagcgccatgttccagcgcaaaggaagaggaaac
gccctcatcctcctcatcatcgctgcgtttaccatcttctggctgccgtatcacctcatc
aacatcctgcaggtgattggtctgatgcagggctcctcctcttctattttaacagcggca
atagtggcgcgtcccaacgtgacggcgttcaccttccttagcagcagcgtgaaccccgtc
ctgtacgtgtttgccggcagctctcacatccgtcaggctggtctgggcttcatggccaaa
ctctttgagggaaccaactcggagtcggcctccacccgcagcagtcgcggctctaatgca
gagagctccgttttcaccaagctgtccgtcaagctgagtcgtaaaggggacggagcgaga
gccgagacccctggtggtgaagacgagaacacagcagacgtgcacaacagagatgagatg
aagactctcaccaccctgcattaa

DBGET integrated database retrieval system