KEGG   Sinocyclocheilus anshuiensis: 107657571Help
Entry
107657571         CDS       T04917                                 

Gene name
ddc
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00350  Tyrosine metabolism
sanh00360  Phenylalanine metabolism
sanh00380  Tryptophan metabolism
sanh01100  Metabolic pathways
Module
sanh_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
sanh_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107657571 (ddc)
   00360 Phenylalanine metabolism
    107657571 (ddc)
   00380 Tryptophan metabolism
    107657571 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107657571 (ddc)
Enzymes [BR:sanh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107657571 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     107657571 (ddc)
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107657571 (ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107657571
NCBI-ProteinID: XP_016301208
Position
Unknown
AA seq 437 aa AA seqDB search
MDAAEFRRRGKEMVDYVADYLENIEKRQVYPDVEPGYLRSLIPEEAPEEAESYEDVVKDI
ERVIMPGVTHWHSPYFYAYFPTAHSFPAMLADMLCGAIGCIGFSWAASPACTELETVMLD
WLGKMLKLPEDFLAGTEGRGGGVIQGTASEATLMALLAARSKIVKLIQADHPERSETDII
SKLVAYSSDQAHSSVERAGLIGGVRMKKMPTDSKFSVRGAALQKVLEEDRAAGLIPFFVC
ISLITTIFFFADSFNFNPHKWLLVNFDCSAMWVKKRSDIIGAFKMEPLYLKHDHQESGIV
TDYRHWQIPLGRRFRSLKMWFVFRMYGLKGLQAYIRKHVGLAKEFESLVRADQRFEISAD
VVLGLVCFRLKGSNELNETLLKRINRARKIHLVPCQLAGKFVLRFAMCARTTESRHVQEA
WSHISHLASELLQELPH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgcagagttccggagacgcgggaaggagatggtggactatgtggccgattat
ttagagaacattgagaagaggcaggtttaccctgatgtggaacctggatatctcaggtca
ctgattcctgaggaagccccagaggaggcagagagctatgaggatgtggtcaaagacata
gagagggtgatcatgccaggggtgacacactggcacagcccgtacttctatgcatacttt
cctactgcccactcttttcctgcaatgctggctgatatgctgtgtggggccattggctgc
attggattctcttgggcagcgagtcctgcctgtacagagctggagacagtgatgctggac
tggctggggaagatgctgaagctaccagaagatttcttggctggtactgagggcagaggg
ggaggggtcatccagggcactgccagtgaagccactctcatggctcttcttgctgctcgt
tccaaaatcgtcaaactgatccaggctgaccatcctgaacgatctgagacagacattata
tccaaacttgtcgcctactcatctgatcaggcacactcatcggtggagagggcaggtttg
ataggtggagtaaggatgaagaaaatgcccaccgacagtaagttttctgtgcgaggagct
gcactgcagaaagttctagaagaggacagagccgcaggactcataccattttttgtatgt
atatctctaataactacaatcttctttttcgcagactctttcaatttcaatcctcataaa
tggctcctggtcaactttgactgctctgcaatgtgggtgaagaaaagatcagacatcatt
ggagcatttaaaatggagccgctttatctgaagcatgatcaccaagagtcaggaattgtc
actgattatagacactggcagatcccattgggtcgtcggttccgctctctcaagatgtgg
tttgtgttccgcatgtacggactcaaaggtctccaagcctacatccgcaagcatgtagga
ctggccaaagagtttgagtctttggtgagagccgatcaacgcttcgagatctcagctgat
gttgtgctgggcctggtctgctttagactcaagggctccaatgaattaaatgaaactctg
ttgaagaggatcaacagagcacgtaagatccatctggtaccgtgccaactggcaggcaag
tttgttctgcggtttgccatgtgcgctcgtactactgagtcacggcatgttcaggaggcc
tggagccacatcagccacctggcatcagagctgcttcaggaactgccccactga

DBGET integrated database retrieval system