KEGG   Sinocyclocheilus anshuiensis: 107658160Help
Entry
107658160         CDS       T04917                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04060  Cytokine-cytokine receptor interaction
sanh04068  FoxO signaling pathway
sanh04210  Apoptosis
sanh04217  Necroptosis
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107658160
   04068 FoxO signaling pathway
    107658160
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107658160
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107658160
   04217 Necroptosis
    107658160
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107658160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107658160
   04052 Cytokines and growth factors [BR:sanh04052]
    107658160
   04090 CD molecules [BR:sanh04090]
    107658160
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107658160
Cytokines and growth factors [BR:sanh04052]
 Cytokines
  Tumor necrosis fators
   107658160
CD molecules [BR:sanh04090]
 Proteins
  107658160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF GspL_C Tad HemX
Motif
Other DBs
NCBI-GeneID: 107658160
NCBI-ProteinID: XP_016302108
Position
Unknown
AA seq 264 aa AA seqDB search
MSGNFGHSPQPVFMVDSGRGHPKQHRYYHQQMPRSPVPCWTFPPARAEMKKRGCGRMNGT
IVWGLTLILLLVFAALGLGAYQILRLQTEMQRLTQEIPAQMQSLTPQKQVGLNPAELNKN
TQNSAAHLIGHADQSRSAGTLKWEANLGDAFTEGIKYINGGLQVNMTGLYFVYSRVEFLS
PKCNPRDSYTHIMSRQRNGRNRTIMEDHQEGFCTAGSKQPWMTGSHLGSLQHLKQSDWLF
VNVSHPLLISKNYHSNYFGLFKIN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtaactttggccactcaccccagccagtgttcatggtggattctggcagaggt
caccctaaacaacatcggtattaccaccagcagatgcccagatcaccagtgccctgctgg
accttcccccctgcccgagctgagatgaagaaaaggggctgcgggagaatgaatggtacg
atagtctggggactgacactgatacttctgctggtttttgcagccctgggactgggagcc
tatcagatcctgaggttacagactgaaatgcagcggctgacacaggaaatacccgcacaa
atgcagagcctcactccacagaaacaagttggcctgaatcctgctgagctgaacaagaac
acacaaaactctgctgcacacttgataggtcatgcagaccagagcagatcagctggaact
ctgaagtgggaagcaaatctcggtgatgccttcacagaaggcatcaagtacatcaacggc
ggccttcaggtcaacatgaccggtttgtacttcgtttactcccgcgtggagtttctttca
cccaagtgcaaccccagagactcttacactcacataatgagtcggcagagaaacggccgc
aaccggacaatcatggaagatcaccaagagggcttttgtacggcggggagcaaacagcca
tggatgaccggcagtcatctaggctcgcttcagcatctcaagcagtccgattggctgttt
gtcaatgtctcacacccccttctgatcagcaaaaattatcacagcaactattttggcctc
ttcaagatcaactga

DBGET integrated database retrieval system