KEGG   Sinocyclocheilus anshuiensis: 107658243Help
Entry
107658243         CDS       T04917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00140  Steroid hormone biosynthesis
sanh01100  Metabolic pathways
Module
sanh_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
sanh_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107658243
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     107658243
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     107658243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 Polysacc_synt_2 GDP_Man_Dehyd NAD_binding_10 NmrA KR RmlD_sub_bind adh_short Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 107658243
NCBI-ProteinID: XP_016302201
Position
Unknown
AA seq 311 aa AA seqDB search
MTLSGDVCVVTGACGFLGEKLVRLLLEEEKLAEIRLLDRNIQSELIQSFDDCKGETKVSV
FEGDIRDRELLRRACKGAALVIHTASLIDVIGATEYSELYGVNVEGTQLLLEICIQENVA
SFIYTSSIEVAGPNPRGDPIINGNEDTHYSSCLKFSYSKTKQEAEQICLQANGELLHNGG
QLATCALRPMYIYGPGCRFTLGHMRDGIRNGNVLLRMSRREAKVNPVYVGNAALAHLQAG
RALKDSQKRAVMGGNFYYISDNTPPVSYSDFNYAVLSPLGLGYKRGPFCPSHFCISCHSS
WNYCTLCSDLF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactctgtcgggagatgtgtgtgttgtgacgggagcctgcgggtttctaggagaaaag
ctggtcagactgttgctggaagaggagaagcttgctgagatccggctgctggatagaaac
atccagtctgagctaatacagtcatttgatgattgcaagggagagactaaagtgagtgtt
tttgagggggatatcagggaccgtgagctattgagaagagcctgtaaaggagcagcactt
gttatccacactgcatctctcattgatgtcattggagcaactgaatacagtgaattatat
ggagtaaatgttgaaggaacacagctgctgctcgagatctgcatccaagaaaacgtggcc
tccttcatttacactagcagcattgaggtggcaggtcccaatccccgcggtgatccaatc
attaatggcaatgaggacacccattactcctcctgtcttaagtttagctatagcaaaacc
aagcaggaagctgaacagatttgccttcaggccaatggagagctgctccataatggaggt
cagctggctacttgtgcattgaggcccatgtacatctatggaccaggctgtcgttttact
ttaggccacatgagggatggaatccgcaatggaaatgtgctgctgagaatgtcacgacgt
gaggcaaaagtgaatcctgtatatgtgggaaatgcagccctggcacatctacaagcaggt
cgggctctcaaagattctcagaaaagggctgtgatgggtggaaacttctattacatctca
gacaacacgccacctgttagctactcggactttaactatgctgttctttcaccattaggc
ttgggatacaagagaggcccattctgcccttcccacttctgtatctcctgtcattcctca
tggaattactgcacgttgtgctccgaccttttctga

DBGET integrated database retrieval system