KEGG   Sinocyclocheilus anshuiensis: 107660398Help
Entry
107660398         CDS       T04917                                 

Definition
(RefSeq) rho-associated protein kinase 1-like isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04270  Vascular smooth muscle contraction
sanh04350  TGF-beta signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
sanh04810  Regulation of actin cytoskeleton
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107660398
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107660398
   04530 Tight junction
    107660398
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107660398
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107660398
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107660398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107660398
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107660398
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107660398
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107660398
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107660398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Rho_Binding Pkinase_Tyr PH C1_1 Cortex-I_coil HR1 Pkinase_C APH
Motif
Other DBs
NCBI-GeneID: 107660398
NCBI-ProteinID: XP_016305168
Position
Unknown
AA seq 1180 aa AA seqDB search
MGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDYISPEVLKSQGG
DGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFPDDSDISKDAKS
LICAFLTDREVRLGRNGVDEIKRHSFFKNDQWTWENMRETAAPVVPELSSDVDTSNFDDI
EEDRGEEETFPIPKAFVGNQLPFVGFTYYQFPREPAIKTSDKRSSTKEDKSHLENLQKRI
YQLEEQLHSEMQLRDEMEQKCRASNTKLDKIMKELDEERNLRKSVETNMSLLEKDKIMIQ
HRATEHQRKAEQEAEKRRNLENEVSTLKEQLEDLRKMSQNNEKVAQLQNQLRESNDLLRA
ESDTVVRLRKSHTEMGKSMSQLESVNRELQEKSRAAESLKQQLEKELLQLQTTLDTERRS
CSQGSEEIRELQARITGLQEDNKNLKHSLSKVELERKQVQDRCNVLEKEKNSLEIDLNYK
LKTLQQRLDQESTEHRITKAQLTDKYESIEETKSAAMHAVEQNVAEETTLRMRAESRVVE
VEKQCSMLEFDLKQSVQKMEQLMKQKERLEEEVKELRVQLEQESGKRVLAQNELKSWTME
AERLKGSEKQLKQEINAALENKRSVEFQLAQLTKQYRGNEGQMRELQDQLEAEQYFSTLY
KTQVKELKEEIEEKNRQTQETLKKVQDMYSEKESLSAQLDLTMTKAESEQLARALQEEQY
FELSQEHKKATSRYKQEISEKDSTITQLEESNKTLTKDAEILSKEKAELNERLQAREEEF
AAEKEELASTVKANYEKALNIERTLKTQAVNKLAEIMNRKDMKLDQKKRGSTTDLRKKEK
ENRKLQLELNQEKEKFNHMAIKNQKELNEMQAQLAEECTYRNELQMQLDSKESDIEQLRE
KLNDLQLRVDNSSVTSLQPDETDSNIAESRLEGWLAIPYRANIKRYGWKKQYVVVSSKKI
LFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAEADEIPRIFQILYANEGECRKEA
DMESVPQGDKTNCLPHKGHEFIPTLYHFPSNCEACSKPLWHVFKPPPALECRRCHVKCHK
DHLDKKEDVIAPCKVNYDVTSARDMLLLALSQDEQKKWIGHLGKKIPKTPPSTFARASPR
TMSTRSVANQSFRKNPKNMSGKPSRAQSFLQAADTTSSTC
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcattcacagggatgtaaagcctgacaacatgttgctagacaaggcaggccac
ttaaagctggcagactttgggacctgcatgaaaatgaacaaggatggcatggtacgatgt
gacacggcagtaggaactccagactatatttctccagaggtactgaagtcgcagggagga
gacggttactatggccgagagtgtgactggtggtctgtgggggtcttcctgtatgagatg
ctcgtcggtgacacgccgttctacgctgactctctggtgggcacctacagcaagatcatg
aatcacaagaatgccctgaccttccccgatgacagcgacatctcaaaggatgcaaaaagc
ctcatctgtgctttcctcacagacagggaggtgcggttaggacgcaatggagtcgacgaa
atcaagcgacatagtttttttaagaacgaccagtggacatgggagaacatgagagagacg
gctgctccagtggtgccggagttaagcagtgatgtagacacaagcaactttgacgacatt
gaggaagatcgaggggaggaggagacattccccattcctaaagcatttgtaggcaaccag
cttccattcgtgggctttacctactaccagtttcctcgggaaccagctataaagacaagt
gacaaacgcagctcgacaaaggaagataagagtcatttggagaatcttcagaagagaatt
tatcagctagaagaacaacttcacagtgagatgcagctgagagacgagatggagcagaag
tgcagggcatccaatacaaagctagacaagataatgaaagagttagacgaagagcgtaac
ctaagaaagagtgtggagactaacatgtctttactggagaaagacaagatcatgatccag
cacagagcaacagaacatcagagaaaggctgaacaggaggctgaaaaacgaagaaatctg
gagaatgaggtgtctactttgaaggagcagctggaagacttgaggaaaatgagtcaaaac
aatgaaaaggtcgcccagctgcagaaccaactgagggaatccaacgaccttctgcgggct
gagtctgacacggtggtgcgtttgaggaagagccacacagagatggggaagtccatgagc
cagctggagagcgtgaatcgcgagctgcaggagaagagccgcgccgcagagagtctcaaa
caacagctggaaaaagagctgctccagctgcagaccacgctagacacagagagacggtcc
tgcagccagggctcagaggagatcagagagctgcaagctcgtatcacgggtctacaagag
gacaacaagaacttgaagcacagtctgtctaaagtggagctggagagaaaacaagtgcag
gacagatgcaacgttttagagaaggagaagaacagtctggaaatcgacctgaactacaag
ctgaagactctacagcagcggctggaccaggaatccacagagcatcgcatcacgaaggct
caactcacagacaaatacgagtcaatcgaggagaccaagtcagctgctatgcacgcggtg
gagcagaatgtggcggaggagaccacgctgcgcatgcgagcggagagcagggtggtggag
gtggagaagcaatgctccatgctggagtttgacctcaagcagtctgtgcagaagatggag
cagctgatgaagcagaaggagaggctggaggaagaggtgaaggagctacgggtgcagttg
gagcaggagtccgggaagcgtgtgctggcccagaatgagctgaagagctggacgatggag
gccgagcgcctgaaaggatcagagaagcagctcaaacaggagatcaacgcggccctcgag
aacaaacgctccgttgagttccagctggcacagctcacaaagcagtaccgaggaaatgag
ggtcagatgagggagcttcaggaccagctggaggctgagcagtatttctcaacactctat
aaaactcaggtgaaggagctgaaggaggagatagaggagaagaatcgacaaactcaagag
actctcaaaaaagtccaggacatgtactcagagaaggagtcgctgtctgctcagttggac
ctgaccatgacgaaggccgagtcggagcagttggcgcgcgcgctgcaggaagagcagtat
tttgaactctctcaggagcacaagaaagccacctcacggtacaaacaggagatctcagag
aaggactcgaccatcacacagcttgaggaatccaataaaacccttaccaaagatgcggag
atcctcagtaaggagaaggcagaactgaacgagagactccaagctcgagaagaagagttt
gcagcagagaaggaggagctggcaagcacagtaaaggccaattacgagaaggcccttaat
atagaaagaactctgaagacccaggcggtgaataagctggcggagatcatgaaccggaag
gacatgaagttggaccagaagaagagaggcagcaccactgacctgcgcaagaaagagaag
gagaaccgcaagctgcagctggagctcaaccaggagaaggagaagttcaaccacatggcc
atcaagaaccagaaggagctgaacgagatgcaagcgcaattggcagaggagtgcacgtat
cgcaacgagttgcagatgcaactggacagtaaggagagtgacattgagcagctcagagag
aaactcaacgacttgcagctccgcgtggacaactccagcgtcaccagcctgcagccagat
gagacggacagtaacatcgctgaatcaaggcttgaaggctggctagcgataccatatagg
gctaatataaaaagatacggctggaaaaagcagtatgttgtggtgagcagtaaaaaaatt
ctcttttacaatgatgagcaagacaaggagcagtctaacccctctatggtactagatatc
gacaaacttttccatgtgcgtcctgtcacgcaaggtgacgtttatcgagctgaggccgat
gaaattccaagaatattccagatcctgtatgctaatgaaggtgagtgcaggaaggaggcg
gacatggagagtgttcctcagggtgataagaccaactgcttgccccacaaaggccatgag
ttcatccccaccctctatcatttcccctctaactgcgaggcttgctccaaaccgctgtgg
cacgtgttcaagcctccgccagccctggagtgccgccgatgccacgtcaagtgccacaag
gaccatttggacaagaaggaggatgttatcgccccttgcaaagtgaattatgatgtgaca
tcagctagagacatgctgctcctggccttgtcccaagacgagcagaagaaatggatcggc
catctcggcaagaagattcccaagacccctccatctaccttcgcaagggcgtctccacgc
acgatgtccactcgctctgtagcaaaccagtccttccgcaagaaccccaaaaacatgtcg
ggcaagccaagcagggcgcagtcctttctccaagcggcagacacaacatccagtacatgc
tga

DBGET integrated database retrieval system