KEGG   Sinocyclocheilus anshuiensis: 107660799Help
Entry
107660799         CDS       T04917                                 

Definition
(RefSeq) transforming growth factor beta-2-like isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04060  Cytokine-cytokine receptor interaction
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04218  Cellular senescence
sanh04350  TGF-beta signaling pathway
sanh04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107660799
   04350 TGF-beta signaling pathway
    107660799
   04068 FoxO signaling pathway
    107660799
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107660799
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107660799
   04218 Cellular senescence
    107660799
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107660799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sanh04052]
    107660799
   00536 Glycosaminoglycan binding proteins [BR:sanh00536]
    107660799
Cytokines and growth factors [BR:sanh04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107660799
Glycosaminoglycan binding proteins [BR:sanh00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107660799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 107660799
NCBI-ProteinID: XP_016305704
Position
Unknown
AA seq 414 aa AA seqDB search
MWFINLTLLVLKLSVSADGFSTCQSYNLADHKSKRIEAVRGQILSKLRIRSPQDPEASPP
SESVPVEVMLLYNSTKELLKERARQAEAACERESSEEDYYAKEVQRINMMPLRTDTNSIN
PVPQSPYFRIVGFDVTNVERNSSTLVKAEFRIFRAPNPQARTTEQRVEIYQILKSDDMTA
PSQRYIDSRTVEPQAKGAWLSVDVTETVKEWMAFRERNLGLKISVHCPCCTFVPSTNNIV
PNKSEELEARFAGIDDDLIKQNRRPGMTKGQIEFSTKTPHLILTLLPTDRLESPTKKNRK
KRSAAVTSICSRTDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYLWSADNHY
NMILPLYNKMNPEASASPCCVPQDLEPLTIVYFLGRTPRVEQLSNMVVRSCKCR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcatcaatctaactttgctcgttctcaaactgtccgtgtctgcggacggattc
tccacgtgccagtcctacaacttggccgaccacaaatctaaaaggattgaggcggtgcgc
ggacagattttgagcaagctgcgcatccggagtcctcaggatcccgaagccagcccgcca
tcggagtcggtaccggtggaggtgatgttactttacaacagcacgaaggagctgctgaag
gagcgcgcgcgccaggccgaagccgcctgcgagcgggagagcagcgaggaggactattac
gccaaagaggtgcagcggatcaatatgatgccactgcgcacagatacgaactcaatcaac
cctgttcctcagagcccgtacttcaggatagtgggcttcgacgtcaccaatgtggagcga
aattccagtactttggtcaaagcagaatttcgcatcttcagagcgccaaacccacaggcg
cgcaccacagagcagcgtgtggaaatataccagattctcaaatctgacgacatgacagca
ccgtctcagaggtacatcgactccagaacagttgagcctcaagccaagggggcgtggctt
tctgtcgacgtcacggagactgtgaaggagtggatggccttcagagagagaaatcttggg
ctcaagatcagcgttcactgtccctgctgtacattcgtcccttccacaaacaatattgtc
cctaacaagagtgaagagttggaagccagatttgcaggcattgatgatgaccttataaag
cagaacagaagaccaggcatgactaaaggacagattgaattcagcacaaaaactccccat
ttgatactaaccctgctgcccaccgaccgtctggagagtcccaccaagaaaaaccgcaag
aagagatcagcagcagtcacatccatatgctcacggactgatcagggctgctgtctgagg
tctctgtacattgattttcgtcgggacttgaactggaagtggatccacgaaccaaaaggg
tacaaagcaaatttctgtgcagggaactgtccttacctctggagtgcagacaaccactac
aacatgattctcccgctgtataataaaatgaatccagaagcatcagcatctccgtgttgt
gttcctcaggacctggagcccctcaccatcgtttatttcctaggccgaaccccccgtgtg
gaacagctctccaacatggtggtccggtcctgcaagtgccgttga

DBGET integrated database retrieval system