KEGG   Sinocyclocheilus anshuiensis: 107660852Help
Entry
107660852         CDS       T04917                                 

Definition
(RefSeq) nucleoside diphosphate kinase A-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00230  Purine metabolism
sanh00240  Pyrimidine metabolism
sanh00983  Drug metabolism - other enzymes
sanh01100  Metabolic pathways
Module
sanh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sanh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sanh_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107660852
   00240 Pyrimidine metabolism
    107660852
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107660852
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107660852
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     107660852
Membrane trafficking [BR:sanh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107660852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK PSI_PsaJ
Motif
Other DBs
NCBI-GeneID: 107660852
NCBI-ProteinID: XP_016305765
Position
Unknown
AA seq 213 aa AA seqDB search
MFCVSLSDSIAIDYKSPDAIALESVSAHLHKSLTADDHGLVRAHVRGINFRLLDCRQKIP
MSGNEERTFIAIKPDGVQRGLIGEIIKRFEQKGFKLVAMKLLQADEDLLRQHYCGLKDRP
FFPGLVSFMSSGPVVAMVWEGFNVIKTGRVMLGETNPIDSKPGTIRGDFCVQVVRNIIHG
SDSVESANGEINLWFKPEEISDYTKCQDSWLNG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcgtatcactttcggattccatcgcaatagattacaaatcaccggatgccata
gcactggaatcagtctccgcccacctccataaatcacttactgctgatgatcatggatta
gtgagagcgcacgtgcgaggaatcaacttcagactcttggactgccgtcagaaaatccca
atgtctggaaatgaagagcgcacgttcatagccatcaagcctgatggagtgcagagggga
cttatcggagagatcataaagcgtttcgaacagaagggcttcaagttagttgctatgaag
ttactccaggccgatgaggatcttctgagacagcactactgtggcctgaaggatcggcct
ttcttcccagggcttgtcagttttatgtcctctggccctgtggttgccatggtgtgggag
ggttttaacgttataaaaaccggcagagtaatgctcggcgagactaatcccattgactcc
aagcctgggactatccgaggtgacttttgtgttcaggttgtccggaacatcattcacggc
agtgattctgtcgaaagtgccaatggcgagatcaacctgtggttcaaaccagaggagatc
agtgactacaccaaatgtcaggacagctggctcaacggctga

DBGET integrated database retrieval system