KEGG   Sinocyclocheilus anshuiensis: 107661628
Entry
107661628         CDS       T04917                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00230  Purine metabolism
sanh00240  Pyrimidine metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107661628
   00240 Pyrimidine metabolism
    107661628
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107661628
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 AAA_17
Other DBs
NCBI-GeneID: 107661628
NCBI-ProteinID: XP_016306778
Position
Unknown
AA seq 222 aa
MSPTAKRACPSPLNDSLEKRLKRISIEGNIAAGKSTFVRLLEEYDREWEVVPEPIARWCN
VQTHHTEHEELSTSQKSGGNVLQMMYEKPERWAYTFQSYACMSRIRSQIRSTNGKLREAE
NPVQFFERSVYSDRYIFASNLYESECVNETEWAIYQDWHSWLHKQFGKHIELDGIIYLRA
KPERCLERLHLRGRDEEQGIPLEYLEKLHYKHECWLQHRTMR
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtctcccacagccaaaagagcctgtcccagtcctctgaacgacagcctggagaaaaga
ctgaaacgcatctccattgaaggcaacattgctgcgggtaaatccacttttgttcgcctg
ctggaggaatatgatcgagaatgggaggtagtaccggaacccatcgctagatggtgcaat
gtacaaactcaccacaccgagcacgaggaattgagcacctctcagaagagtggaggaaac
gtgctgcagatgatgtacgagaagcccgagcgctgggcctacaccttccagagctacgcc
tgcatgagccgcatccgctcgcagatcagatccaccaatggaaagctgcgagaggccgag
aatccggtgcagttcttcgaacgatctgtgtacagcgacaggtacatctttgcctctaac
ctctatgaaagtgagtgtgtgaatgaaaccgagtgggcgatctatcaggactggcacagc
tggctgcataagcagtttgggaagcacattgagctggatggcatcatttacttgcgggca
aaaccagaaaggtgtttggagcgattgcatttgagaggaagggacgaggaacagggaatt
ccactggaatatctggagaaactccactataaacatgagtgctggttacagcacaggact
atgaggtaa

DBGET integrated database retrieval system