KEGG   Sinocyclocheilus anshuiensis: 107662017Help
Entry
107662017         CDS       T04917                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04020  Calcium signaling pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107662017
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107662017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sanh04030]
    107662017
G protein-coupled receptors [BR:sanh04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107662017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 107662017
NCBI-ProteinID: XP_016307354
Position
Unknown
AA seq 423 aa AA seqDB search
MRGCEFPQEVLESCHGFDPRAPHRNGSLRIYRYMNLSSTGQMPEMEEVDTNESNGLAKRV
ALISFLSLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIE
LIHQNWIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYGNKMTPLRVAL
MIGGCWIIPTVISFLPIMQGWNSIGINDLIEKRKFSGNSTVCVFMVNKPYALTCSVVAFY
VPLILMVLAYQRIYVTARAHARQISMLQRAGEAGNADSADHQRNHRMRTETKAAKTLCII
MGCFCLCWAPFFITNVVDPFIDYSVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFL
IILCCGHKRYRRPSILGPGATCTATQINGSTHVLKYSVLHNGNHTEQEKLSIQNDTESQE
SCF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggatgtgaatttccacaggaggttttagagtcgtgccatggttttgacccgcgc
gctcctcacagaaatgggtcactccgcatctacaggtacatgaatctgagttccaccggc
cagatgcctgagatggaagaagtagataccaatgagagcaacgggttggcgaagagggtt
gctctcatcagcttcctgtcactggtcatgctcatgagcgtcctgggcaacctgctggtt
atggtggccgtctgcaaggaccggcagctcaggaaaatcaaaaccaactacttcatcgtc
tcgctggcgtttgctgaccttctggtgtcagtgctggtgatgccgtttggtgccatagaa
ctgatccatcagaactggatctacggtgagaccttctgcctggtccgcacctctctggat
gtgctgctgaccaccgcctccatcttacacctgtgctgcatatccctcgacaggtactat
gccatctgttgccagccgctggtctacgggaataagatgacaccgctgagagtggctcta
atgatcggaggatgctggataatcccaaccgttatttccttcctacccataatgcaaggc
tggaatagtattggaataaatgatttgatagagaagcggaagttctctggcaactccacg
gtgtgtgtgtttatggtgaacaagccatatgcgctgacctgctcggtcgtggccttctac
gtaccgctgatcctgatggtgctggcgtaccagcgcatctacgtcacggcgcgggcacac
gctcgacagatcagcatgctgcagcgggccggagaagcagggaacgcggacagcgcggac
caccaacgcaaccaccgcatgcgcaccgagaccaaggcggccaagactctgtgcatcatt
atgggctgcttctgcctgtgctgggcccctttcttcatcacgaatgtggtggaccccttc
atagactacagtgttcctgagcagctgtgggcggcctgcctctggctgggctacatcaac
tccatgctcaaccccatcctttacgccttcctcaacaagtcctttcgccgtgccttcctc
atcatcctctgctgcggacacaagcgctaccgccgaccttccatcctgggccctggagcg
acctgcacggccacgcagatcaacggctcgacacacgtcctgaagtattcagttcttcac
aatggaaaccacactgaacaggagaaactgtcaatacagaatgacacagagtcccaggag
tcatgtttctga

DBGET integrated database retrieval system