KEGG   Sinocyclocheilus anshuiensis: 107662314
Entry
107662314         CDS       T04917                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107662314 (ankrd53)
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107662314 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank STELLO
Other DBs
NCBI-GeneID: 107662314
NCBI-ProteinID: XP_016307787
Position
Unknown
AA seq 218 aa
MDTVSHRNDNKLGGHERLCRSDVSGSLVRLVRAFPPESDVLHAAACGAREWLSSALKRAR
TPLHNDKHGLSVLHIAALHGHLDCMDLLLEDGGSVDVNSSCPHGRRPVHMVLTAQSRPNT
HACLIYLLEHGAQINVYERCDLSRIWGHRLTARFLKDAMWWKDKQQGIKKSKQLHDLRQV
QCCSVLDLPHLGRSLKPDASPWTEVAMHLAEELKPGHY
NT seq 657 nt   +upstreamnt  +downstreamnt
atggacacagtcagccacagaaacgacaacaaactcggcggtcatgagaggttatgtcgg
tcggatgtttccggatcgctggttcggctggttcgtgcatttccgccagagagcgacgtg
cttcacgccgcagcgtgcggagcgcgtgagtggttgagttcggctctgaagagagcgcgg
acaccactgcacaatgacaaacacggtctcagtgtgcttcatatagcagctctacatgga
catctggactgtatggatctgctgctggaggatggtggttctgtggatgtgaatagcagt
tgtcctcatggacgcagacctgtacatatggtgctgaccgctcagagccgacccaacaca
cacgcctgcctcatttacctgctggaacatggagcccagatcaatgtgtatgaacgctgc
gacctctctaggatctggggccacaggctcactgccaggtttctgaaagatgccatgtgg
tggaaagacaaacagcaggggatcaagaaaagcaaacagctacatgatctcaggcaggtc
cagtgttgcagtgtgctggatctgcctcacttgggtcgctccctaaaaccagatgcctcg
ccctggactgaggtggccatgcacttggccgaggagctgaagccaggacactattag

DBGET integrated database retrieval system