KEGG   Sinocyclocheilus anshuiensis: 107663304Help
Entry
107663304         CDS       T04917                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sanh01002]
    107663304
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107663304
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107663304
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107663304
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107663304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S9 Abhydrolase_2 Say1_Mug180 Peptidase_S15 FSH1 COesterase
Motif
Other DBs
NCBI-GeneID: 107663304
NCBI-ProteinID: XP_016308975
Position
Unknown
AA seq 384 aa AA seqDB search
MRKRKGSADLDSSFTGNVTLLDGSSDLKQCHKKTDAASDPGGSGTGMGRRYRRGGLIWRL
RRILIWVLGIYIAIPVIIKVCPSIQAKLVFLNFVRVPYFIDLKRPEDQGLNHTRNFYLQP
EEGINIGVWHTVPSVMWREAQAKYAEWYDKSFQSSHPVILYLHGNAGTRGGDHRVQLYKV
LSSLGYHVVTFDYRGWGDSEGSPSEKGMTSDALFLYQWIKQRIGQKPLYIWGHSLGTGVA
TNLVRRLCDRGTPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDSITANDIRF
ASDENVNHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNSHKVQFIPFPSSLGYRH
KFIYKSPQLPNILSDFLSAPHPHM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcgaaaaggcagcgcagaccttgacagctcgttcacgggtaacgttacacta
ctggacggcagctccgatctaaagcagtgccacaaaaagacagacgctgcttctgatcca
ggaggttcggggacagggatggggagacgctacaggaggggtggtctgatatggaggcta
aggaggatactgatctgggtgctgggaatctacatcgccatccctgttatcatcaaagtc
tgtccatcaatacaagcaaaattagtatttttaaactttgtgcgagtgccgtattttata
gatctgaagagaccagaggatcagggcttgaatcacactcgcaacttctacctgcagccc
gaggagggaatcaacattggagtgtggcacacagtaccttcagtgatgtggagggaggct
caggcaaaatatgctgaatggtatgacaaaagcttccagtccagtcatccagtcatcctg
tatctccatggcaatgctggaacaagaggaggggatcacagggttcagctgtacaaggtt
cttagttcattgggctaccatgtagtcacatttgattatagaggttggggtgactctgag
ggcagcccttcggagaaaggcatgacgtcagatgctctcttcctctaccagtggataaag
cagcggattggccagaagcccctgtacatctggggtcactcgcttggcacaggagtggcc
actaacctagtgagacgtctgtgtgacaggggaacgcccccagacgccctaattttagag
tcaccctttaccaatatcagagaggaagccaagagccatcccttctctatggtttacaga
tacctgccaggctttgactggttcttcctggattctataactgcaaatgatatccgattt
gccagtgatgaaaatgtcaaccacatatcctgtccggttctgatactgcacgcagaagat
gacacagtcgtacctttccagctgggaaagaagctatatgatttggcggctcagagcaag
agtctgaacagtcataaggttcagttcatcccgttccccagctctctgggctacagacac
aagttcatctacaagagcccacagctaccaaatatactcagtgattttctcagtgcgccg
catcctcacatgtag

DBGET integrated database retrieval system