KEGG   Sinocyclocheilus anshuiensis: 107663326Help
Entry
107663326         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107663326
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107663326
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107663326
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: STE group
  STE20 family
   107663326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like Kdo FTA2 APH Activator_LAG-3
Motif
Other DBs
NCBI-GeneID: 107663326
NCBI-ProteinID: XP_016309023
Position
Unknown
AA seq 373 aa AA seqDB search
MNDEEDEIKLEINMLKKFSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVK
NTKGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQL
DRTVGRRNTFIGTPYWMAPEVIACDENSEATYDYRSDLWSCGITAIEMGEGAPPLCDMHP
MRALFLIPRNPPPRLKSKKWSKKFFSFIETCLVKNYIHRPSTEQLLKHPFIRDQPNERHV
RIQLKDHIDRTRKKRGERDETEYEYSGSEEEEEEAQEQEGEPSSIVNVPGESTLRRDFIR
LQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEVGLQYKY
CDYCLNLAYTCSA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgaggaggatgagattaaacttgagattaacatgctgaagaaattctcccac
cacagaaacattgccacatactatggtgcttttatcaagaagagtcctcctggacatgat
gaccagctgtggttggtcatggagttttgtggtgctggatctataacagaccttgttaag
aacaccaaaggcaacagtttgaaagaagactggattgcatacatctccagagagattctg
agaggtctggcccatttgcatgcccaccatgtcatccatcgtgacattaagggtcagaat
gtgctgttaacagagaatgccgaggtgaaattagttgactttggtgtgagcgctcagttg
gacaggacagttggcagaagaaacactttcattggcactccttattggatggcgccagag
gtcattgcctgtgatgagaactcagaagcgacatatgactatagaagtgacctgtggtcg
tgtggtatcactgctatagaaatgggtgaaggagctcctcctctatgtgacatgcatcca
atgcgcgcccttttccttattcccagaaatcctcctccacggctcaaatcaaagaagtgg
tccaagaagttcttcagctttattgaaacctgcctggtgaagaattacatccatcgcccc
tctacagagcaactgttgaaacatcctttcattagagaccaacctaacgagagacatgtt
cgcatccagctcaaagaccatatagaccgcactcgtaagaagagaggagagagagatgag
acggaatatgagtacagtggaagtgaagaagaggaagaagaggcacaagaacaggaagga
gaacccagttctatagtgaacgtgcctggtgaatctactctgcgacgtgacttcattcgt
ctgcagcaagagaataaggagcgatcagaggcactgaggagacaacagctactccaggaa
cagcaactccgagaacaggaggaatataagcggcaattgttggctgagagacagaaacgc
attgaacagcagaaggagcaaagaagacgacttgaggaggttgggcttcaatataaatat
tgtgattattgtcttaatcttgcttatacttgttctgcatga

DBGET integrated database retrieval system