KEGG   Sinocyclocheilus anshuiensis: 107663513
Entry
107663513         CDS       T04917                                 

Definition
(RefSeq) uncharacterized protein LOC107663513 isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107663513
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107663513
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3
Other DBs
NCBI-GeneID: 107663513
NCBI-ProteinID: XP_016309226
Position
Unknown
AA seq 637 aa
MCKMFIAVFYCVSVCCYTSTPRCSVSLWLFHRCKAVCQEPKGSFSAHLGFEVFGEMIPPG
DRLYAGKKRRKPVQKQKPEKAGQKSNPSKRHRDCLNAELDMLASLLPFSADVISKLDKLS
VLRLSVSFLRVKSFFQAVQEEENRSSDTSTSEQKKEILPRVIESDLLLKSLPGFALIVSS
DGVIFYASCTIVDYLGFHQTDVMHQKVFDYIHVEERQEFHRQLHWAMNPGQQDTVDEDAV
MGHLYSSEEPDGVPPKLSPFLTRCFVARVRCLLDSTSGFLNMQFQGSLKFLQGQKRKTDS
GALLPPQLALFCVAVPLVLPSIMELKMKSMMMKSKPNRSGSSDKRQQVSHGSFDCEDMQC
LNWTSTSGHDGSCSAMANRKYRGEGCKTQDEPLNFCVSTLGISRLQAVEPSWDAHCPVAL
RTGPSENYLPGSFYKHSHSGKLRYGCNTELQKLESDCINRKAERRSTQNECFNVIPEVAI
KTEDSDSENECNAYGSLWRPEYAQVKTEAEYYDCFTSYQRGKAVISPPINGHHKYLCAGV
SRPLKCVLNKDMNHSEAPISSQDGYAFSNDHKSCMQHDIRLTCEFKSHNLLHTVKQELDN
SPPWCADVSQGNVRQRITSNYTMNTVLHKANPYVYMQ
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgtgtaaaatgtttatagcagttttttattgtgtctctgtttgttgttacacttccaca
cctcgttgttctgtttccctctggttgttccacaggtgtaaagctgtttgccaggaacca
aaaggctcgttttcagcgcatcttggttttgaggtctttggagaaatgattccgcctgga
gaccgtctgtacgccggaaagaaaaggagaaaacctgtgcagaaacagaaaccagagaaa
gcaggtcagaaatcgaatccatccaagcgtcatcgcgactgtctgaatgcagaactggac
atgttagcgagtctgctgcccttcagtgcagatgtcatctccaaactggacaaactctca
gtgctgaggctcagcgtcagcttcctgcgagtgaagagcttctttcaagcggtccaagag
gaagaaaatcgcagcagtgatacctcgacctcggagcagaagaaagagatcctgccccgt
gtcatagagagtgatcttctcctaaagtctctccctggatttgcactgatcgtgagctcg
gatggcgttattttctatgcatcatgcactatcgttgactacctgggatttcatcagacg
gatgtgatgcatcagaaggtctttgattatatccatgtggaggagcgacaggagtttcac
aggcagctccattgggcgatgaaccctggccagcaagacactgttgatgaggatgctgtg
atgggtcatctgtatagctctgaagagcctgacggcgttcctcctaaattgtctccgttc
ctcacacggtgcttcgtcgctcgagtccgctgcctgctggacagcacctctggcttcctg
aacatgcagtttcagggcagcctgaagttcctgcagggtcagaagaggaagacagactct
ggagctctgctgccgcctcagcttgctctgttctgtgtggctgttcctctagtcctgccg
tccatcatggagctcaagatgaagagtatgatgatgaagagcaaacccaataggtctggc
agcagtgataagcggcagcaggtttcccatggctcatttgactgtgaagacatgcagtgt
cttaactggacaagcacatccggtcatgatggttcgtgttcagccatggccaacaggaag
tacagaggagagggctgcaaaacccaagacgaacctctcaacttctgtgtttctactctg
ggcatctctagattgcaggctgttgaaccttcctgggacgcccactgtcctgttgcctta
cgcacggggcccagtgaaaactacctgcctggaagcttctataagcacagccattctgga
aaattacgatacgggtgtaacacagaattgcagaagcttgagagtgattgcatcaacagg
aaggctgagagaaggtccacgcagaatgaatgttttaacgtgattcctgaagtggccatt
aagactgaagattcagactctgagaatgagtgtaatgcatacgggtcactttggcgccct
gaatatgcacaggtgaaaaccgaggctgaatattatgactgttttacttcatatcaaagg
ggcaaagctgtcatcagtcctcccatcaacggacaccacaagtatctgtgtgcaggagtc
agcagacctcttaagtgcgtcctgaacaaagacatgaatcactctgaagctcctatcagc
agtcaggacggatatgcgttttcaaatgatcataaaagctgcatgcagcatgatatccgg
ctgacttgtgagttcaagagtcataaccttctgcacacggtcaaacaagaacttgacaac
tctccaccttggtgtgctgatgttagtcaagggaatgtgcgacaacgtattacttcaaat
tacactatgaacactgttctacacaaagcaaacccgtatgtttacatgcagtaa

DBGET integrated database retrieval system