KEGG   Sinocyclocheilus anshuiensis: 107663890Help
Entry
107663890         CDS       T04917                                 

Definition
(RefSeq) ornithine carbamoyltransferase, mitochondrial-like isoform X1
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00220  Arginine biosynthesis
sanh01100  Metabolic pathways
sanh01230  Biosynthesis of amino acids
Module
sanh_M00029  Urea cycle
sanh_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107663890
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     107663890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 107663890
NCBI-ProteinID: XP_016309776
Position
Unknown
AA seq 372 aa AA seqDB search
MFAFKNRIYFSLKFAKCCQSRNFRVGKAALDSVNLEGRSFLTLKDFNAEEIKPILWVSAD
LKHRIKHRGEYVPLLQGKSIAMIFEKRSTRTRMATETGFSLLGGHPCFLTPQDIHLGVNE
STTDTARVLSGLADVVLARVYSHSSLEHLDIDASIPVINGLSDLYHPIQVLADLSTLQEH
YGSLKGLTLAWIGDGNNVLHSFMMSLAKLGVNLKVATPKGYEPDANVTQEAQLLSKQFGT
KLQFLMDPMEAARHSSVLVTDTWVSMGQEEEKKKRLKDFHGYQITMQTGSVAAPDWTFLH
CLPRKAEEVDDEVFYSPRSLVFTEAENHKWTIMGLMVCILTDYTPQIPKLKFKKNMWEKD
IKNRILSSVCHL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctttcaaaaacagaatatattttagtctgaaatttgcaaaatgttgccaaagc
aggaattttagagtgggaaaagcagctctggacagtgttaacctggagggtcgcagcttt
ctaacactgaaggattttaatgcagaggaaattaaacctatcctgtgggtttctgctgac
cttaaacatcgaataaaacacaggggcgagtatgtcccattacttcaaggcaaatctatt
gccatgatatttgagaagaggagcactaggacccgcatggccactgaaacagggttttct
ctgttgggtggccatccatgttttctcacaccccaggatattcatctaggagtcaatgag
agcaccacagacacggccagggtgctctctggtttggcagatgttgtgttagctcgcgtg
tatagtcactcatctctggagcacctggatatagatgcttctataccagtcatcaatggc
ctatctgacctctaccaccctatacaggttctggctgacctatcgacactacaggagcac
tacggctcattaaaaggcctcactttggcttggataggtgatggaaacaatgttcttcac
tcctttatgatgtcattggctaaactaggtgtcaatctaaaagtggccacacccaagggt
tatgagccagatgctaatgtcactcaagaggctcagcttctgtctaagcagtttggtacc
aagttgcaattcctgatggatccaatggaggcagcacggcacagtagtgtgctggttact
gacacttgggtgagcatgggccaagaggaggagaagaagaagagactaaaagatttccat
ggttaccagattaccatgcagacaggaagtgtggctgcaccagactggacatttctgcac
tgtctcccacgtaaagcagaggaagtagacgatgaagttttctactcaccacgttccctt
gtgttcacagaggctgagaaccacaagtggaccattatgggtttgatggtgtgcatcctg
acagactatacgccacaaattcccaaactcaaatttaaaaaaaatatgtgggaaaaagac
attaaaaacagaatactgtcatctgtctgtcatctgtaa

DBGET integrated database retrieval system