KEGG   Sinocyclocheilus anshuiensis: 107664382Help
Entry
107664382         CDS       T04917                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107664382
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sanh04030]
    107664382
G protein-coupled receptors [BR:sanh04030]
 Rhodopsin family
  Lipid
   Leukotriene
    107664382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx PSD5 7tm_4 RAI1
Motif
Other DBs
NCBI-GeneID: 107664382
NCBI-ProteinID: XP_016310423
Position
Unknown
AA seq 356 aa AA seqDB search
MNATAYFQADEETELGLVGACVILGVCFLVGTPGNLLVVWTIMKHVKQRSHTVLLILHLA
AADLLVLITLPLWIYSLARSWVFGEAACKAMVYIINACMYSSVFIITTMSVERFLAIRYP
FASVVWRRRQALNKVLLMIWMASFLLSIPVIVTHTLGEVNGQNQCLFREFETDAQEAVLL
ILESLIGFVIPFFTLLVCYGCLFSRIAQMNFKSKHKSTVLICSVVVMFALCWIPHHTGNF
LALTSLTLKHSSPDMAKSLEDACTTMTFIAGALTFISSSVNPVLYMFAARAFRSSLRETG
IQKLFQHLSSAASGEGNKELSFVSKRQSSHSTNSQCLTDSKVRVDVAMESCISTSD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctacagcttattttcaggcagatgaggagaccgagctgggcttggtgggggcc
tgtgtgatcctgggtgtgtgtttcctagtgggcacacctgggaacctgctggtggtgtgg
accatcatgaagcatgtgaaacagcgttcacatacggtgcttctcatcctccacctggca
gctgcagatcttctggtgctgatcactctgccgctctggatctactcgctggcccgttcc
tgggtgtttggagaggcagcctgcaaagccatggtgtacatcatcaatgcctgcatgtac
agcagcgtcttcatcatcaccaccatgagtgtggagcgcttcctggccatcagatacccc
tttgcctcagtcgtctggaggaggagacaagcactgaacaaggtacttctaatgatatgg
atggcttcatttctcctcagtattcccgtcattgtaactcacactttgggagaagttaat
ggacaaaatcaatgtctgttcagggagtttgagactgacgcccaagaggctgtgttgctc
attttagaatctcttataggctttgtcatcccttttttcactctgttggtctgttacggc
tgcctcttcagtcgcatagcgcagatgaacttcaagtccaagcacaagtcgacggttctc
atctgcagtgtggtggtgatgttcgctctctgctggattcctcaccatacagggaacttt
cttgccctcacctcgctcactctcaagcattcaagccccgacatggcgaaaagtttggag
gacgcctgcaccacaatgacctttatagcaggagccctgacattcatcagtagctcagtc
aatccagtgctttacatgtttgccgcgcgtgccttccgcagctcgctccgggaaactgga
atacagaagctcttccagcatttgtccagtgcagcatcaggtgaagggaataaagagtta
tcatttgtgtccaaaagacagagttcacacagcaccaactcacagtgcctcacagactca
aaagtgcgggtagatgtggctatggaatcatgcatcagtacttcagactga

DBGET integrated database retrieval system