KEGG   Sinocyclocheilus anshuiensis: 107664416Help
Entry
107664416         CDS       T04917                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1-like isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107664416
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107664416
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: Other
  CAMKK family
   107664416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 107664416
NCBI-ProteinID: XP_016310464
Position
Unknown
AA seq 503 aa AA seqDB search
MAMNSDPGCMGVGPDPDSSQTTEMTDKMSAVSLKSDTSSSVVKNGTGVKKAPPKRPHLSG
RKMSLQERGTYVSSGSGADRYSRIARQPTIESKRVSISDSQDCTQLNQYKLKSEIGKGSY
GVVKLAYNEDDDKYYAMKVVSKKKLMKQYGFPRRPPPRGPKAAQGEQPKVLGPLERVYQE
IAILKKLDHLNIVKLVEVLDDPAEDNLHMVFELMQKGPVMEVPSDNPFSEDEARHYFRDI
VLGIEYLHYQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAP
ETLSDNRKSFSGKALDVWAMGVTLYCLVYGKCPFIDEYILALHSKIKSKPVEFPETPAIS
EGLKNLVSQMLDKNPDTRITIPEIKVDPWVTQDGTDPLPLEEEHCTVVEVTEEEVQNSVK
FVPSLSAVILVKAMLRKRSFGNPFECPSRREERSMSAPGSLLMDSWPFRPSFKLQPSLRK
GSSGEAGREVELEDLHEDEPPTS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaacagtgatcctggttgcatgggggtgggccctgacccagactcctcccag
accactgagatgactgacaagatgtctgcggtgtcgctaaagtccgatacctcctccagt
gtagtgaagaatgggacaggtgttaagaaagctccgcccaagaggccacacctgtcaggc
aggaagatgtcattgcaagagagaggaacatacgtgtcttctgggagcggggctgaccgc
tattcccgcatagccagacagccgaccatcgagtccaaacgagtgtccatctcagattcg
caggattgcacccagcttaaccagtacaagttaaagagtgagattgggaagggctcatat
ggtgttgtcaagttggcgtacaacgaggatgatgacaaatattacgcaatgaaagtggtg
tctaagaagaagctgatgaaacagtacggttttccccgccgccctcctccccgaggtcct
aaagcagcccagggggagcagcccaaagtgcttggtcctctggagagggtttaccaggag
atagctatcctgaaaaaactggaccacctcaacatagttaaactggttgaggtgctggat
gatccagcggaggacaaccttcacatggtgtttgagctgatgcagaagggccctgtgatg
gaggtccccagcgacaatccgttcagtgaggacgaggcccgccactacttcagagacatt
gttttgggcatcgagtacttgcactatcagaagatcgttcacagagatatcaaaccatca
aatttattacttggagatgacggtcatgtcaagatcgcagattttggggtcagtaaccag
tttgagggtaacgatgccttgctctccagcactgctggtactcctgccttcatggcccca
gagacgctgtcagacaaccgcaaaagctttagtggaaaggctctggatgtgtgggctatg
ggagtgaccctctactgtttagtgtatggaaagtgcccatttattgatgagtacatactg
gcacttcacagtaagatcaagagtaagccggtggagttccccgagactccagctatcagt
gagggtctgaagaacctggtctcacaaatgctggacaaaaacccagacaccaggatcacc
attcctgagatcaaagtggacccttgggtgactcaggatggcactgaccctttgccttta
gaagaggagcactgtaccgtggtggaggtcactgaagaagaggtgcagaactcagtgaag
tttgtcccaagtctgtctgctgtgattttggtcaaagccatgttaaggaagcgttccttt
ggcaatccatttgagtgtcccagcaggagagaagagagatccatgtctgcaccaggcagt
ctgctcatggactcttggccgttccggccctcttttaaactccagccctcattaagaaag
gggagtagtggagaggctggtagagaagttgagctcgaggacttgcatgaggacgaacca
cccacctcttga

DBGET integrated database retrieval system