KEGG   Sinocyclocheilus anshuiensis: 107665786
Entry
107665786         CDS       T04917                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sanh01002]
    107665786
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107665786
Peptidases and inhibitors [BR:sanh01002]
 Metallo peptidases
  Family M1
   107665786
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107665786
NCBI-ProteinID: XP_016312293
Position
Unknown
AA seq 939 aa
MFFAQSWCLCCTTFAVLFCGLFVGSHAMTVNTDTNALPFPWDKIRLPETVKPQHYDLLIH
PNLTSLTFIGVVQILIELEQDTRAIILHSKNLQISKAQLLGPRHPQDLQISEFEAYEQIA
LFSDGFTFEKGNHVVHLEFYANLSDSFHGFYKGRYTTNSGEVRTLASTQFEPTHARAAFP
CFDEPAFKANFTIRVRRESRHISISNMPKLRTVEMADGLLEDQFDTTVKMSTYLVAFIIS
DLQSISKKSQHGVEISVYTVPEKISQAEYALNTAVTLLDFYDDYFDIPYPLPKHDLAAIP
DFQSGAMENWGLSTYRESGLLFDPEKSSSSDKLGITKVIAHELAHQWFGNLVTMQWWNDL
WLNEGFAKFMEYVSVNITHPELQVDDYFLEKCFTAMSVDSLTSSHPISTPVENPAEISEM
FDDVSYRKGACILNMLRDFLTPEAFKYGIIHYLKTHSYQNTVNAHLWESLTNICTSDELD
SGRLKLDGFCSKSRAESPASQKWFMEDSVDVQAIMDTWTLQEGFPLITVEVKGQEVTLKQ
ERFLREANSSKTSNTSSFLWQVPLTYITSHCSAVQRFLLKSEKDVLYLPKKVDWIKLNVD
LRGYYIVHYKSGGWDALINQLQQDHSVFSSNDRASLIHDIFQLVSIEKIPLDKALNLSLY
LSKESEIMPVTQGFNELVPLYKLMEKRNMEELENQLKGHLVKLFKTLIDRQSWSDDGSVS
ERMLRNYLLLFACVRRYPSCISTATRLFQQWKESDGKMWLPTDVSLVVYTEGARTDEGWD
FLLEKYKRSVSPSEKWMIKAALSYSPLAHKLQWLLERSIEGEIIKTQDLPSLVISVSKNP
KGFKLAWDFLKTNWGKLVKKFDLGSSAISRMAVGVTDQYSTREMLDEVQSFFGSLAQDQG
SGLRSVQQALQKIQQNIRWMDRNVPLLKAWLDRNSLIES
NT seq 2820 nt   +upstreamnt  +downstreamnt
atgttcttcgcccagtcttggtgtttatgctgcactacatttgcagttttattctgtggt
ctttttgttggcagccatgcaatgactgtcaacacagatacaaatgccttgccttttccc
tgggataagataagattgccagaaacagtgaagccccagcactatgacctcctgatacac
cccaacttgacctccctgaccttcatcggagtggtccagattctcatagagctagagcag
gacaccagagccatcatccttcacagcaagaacctgcagatctccaaagctcagctcttg
ggccccagacatcctcaggatctgcaaatcagtgagtttgaagcctatgaacagatcgca
ctcttttctgatggcttcacatttgagaaaggaaaccacgtggtgcatttggagttctac
gccaacttatcagatagttttcatggcttttataaaggcagatataccacaaacagcgga
gaggtcaggacgttggcatccactcagtttgagccgacgcatgctcgagctgccttccct
tgttttgatgaacctgcatttaaagccaactttaccatccgtgtgcgccgagaatccagg
cacatttccatatccaacatgcccaagctgagaactgtagaaatggctgacgggctgctc
gaggatcagtttgacacgacggtgaagatgagcacctacctggtggccttcatcatctcc
gatttacagtccatcagtaaaaaaagccagcatggagtcgagatatcagtgtatactgtt
cccgagaagatcagtcaggcagaatatgctctcaacaccgccgtcacactgctggacttt
tatgatgattattttgacattccgtatccacttcccaaacacgatcttgcagcgatccca
gatttccagtcaggtgctatggagaattggggcctgtcgacttacagagagtccggtttg
ctctttgaccctgagaaatcttcttcctcggacaaactgggaatcactaaagtcattgcc
catgaactagcccatcagtggtttggaaacctggtcacgatgcagtggtggaacgacctg
tggttaaacgagggctttgccaaattcatggagtatgtgtccgtcaacatcacccaccct
gagctgcaagtggatgattatttcctggagaaatgcttcactgctatgtcagtggactct
ttaacctcctcacaccccatttccactccagtggagaatcctgcggagatcagcgagatg
tttgatgacgtttcctaccggaagggtgcgtgtatcctgaacatgttgagggatttcttg
acgccagaggctttcaagtacggtattatacactacctgaagacacacagctaccagaac
acagtgaacgctcacctctgggaaagtcttaccaatatctgcacttctgatgaattggat
tcagggagactaaaactcgatggattctgttccaaaagcagggctgaatctccagcctct
cagaaatggttcatggaggacagtgttgatgttcaagccattatggacacctggacgctg
caggagggctttcctttaatcacggtggaggtcaaaggtcaagaggtcaccctcaaacag
gagcgcttccttagagaagcaaactcttcgaagacttcaaatacatcaagcttcctgtgg
caggttcctctgacttacatcaccagtcactgtagtgcagtgcagcgtttcttgctgaaa
agtgaaaaagatgtgttgtacctgccaaagaaggtggactggattaaacttaacgtggac
ctgcgggggtattatattgtacattataagtcaggaggctgggacgctttgatcaaccaa
ctccagcaagaccacagtgtgttcagcagcaacgacagagccagtctgatccacgacatc
tttcagctggtcagcattgagaaaatcccactggacaaagctctgaatctgagtttgtac
ctcagtaaagagtcggagatcatgccggtgacgcagggctttaatgagctggtgccgctt
tacaaactcatggagaagagaaacatggaggaactggagaaccagctgaagggtcattta
gtgaagttattcaagacgctgattgaccgccagagctggtctgatgacgggtctgtgtcc
gagcggatgctcaggaactatctgctgttgttcgcctgcgtccgccgttacccatcctgc
atcagcaccgccactcgactcttccagcagtggaaggaatccgatggcaaaatgtggctg
cccactgacgtcagtttggtggtctacactgaaggggcgcgtacagacgaaggctgggac
ttcctgttggagaaatacaagcgatccgtctcgccatcggagaagtggatgattaaagcc
gccctctcgtacagtccattagctcacaagcttcagtggcttttggaaagaagcattgaa
ggagagatcataaaaactcaagacctgccgtcgctggtcatcagcgtcagtaaaaaccca
aaaggtttcaaactcgcctgggacttcttgaaaaccaactgggggaaacttgtgaaaaag
tttgatctcggttcgtctgcgatatctcgcatggcggtcggtgtgaccgatcagtattcc
accagagaaatgctcgatgaggttcagtctttcttcgggtcactagcgcaggatcagggc
tctgggctccgcagcgttcaacaggccctgcagaaaatccagcagaacatccgctggatg
gacaggaacgtcccactactgaaagcctggctggacagaaacagtctgattgagtcctga

DBGET integrated database retrieval system