KEGG   Sinocyclocheilus anshuiensis: 107665920Help
Entry
107665920         CDS       T04917                                 

Gene name
ears2
Definition
(RefSeq) probable glutamate--tRNA ligase, mitochondrial
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00860  Porphyrin and chlorophyll metabolism
sanh00970  Aminoacyl-tRNA biosynthesis
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107665920 (ears2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107665920 (ears2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sanh01007]
    107665920 (ears2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sanh03016]
    107665920 (ears2)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sanh02048]
    107665920 (ears2)
Enzymes [BR:sanh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     107665920 (ears2)
Amino acid related enzymes [BR:sanh01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   107665920 (ears2)
Transfer RNA biogenesis [BR:sanh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107665920 (ears2)
 Prokaryotic type
   Other AARSs
    107665920 (ears2)
Prokaryotic defense system [BR:sanh02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    107665920 (ears2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 107665920
NCBI-ProteinID: XP_016312470
Position
Unknown
AA seq 509 aa AA seqDB search
MFSVLRKVCWRRGVCTRHPAPAPRVRFAPSPTGFLHLGGLRTALYNYLFAKQRGGTFILR
LEDTDQSRLIPGAADDIEDMLEWAGIPPDESRRRGGGYGPYVQSERLQLYSQAASALLQT
GHAYYCFCSNQRLDLLKREAQRSGQVPRYDNRCRELPPEQVQQKLAQGIPCVIRFKLVSG
AEVFQDLVFSWTRHDPAAAEGDPVILKADGFPTYHLASVVDDHAMRISHVLRGSEWLIST
AKHLQLFRALRWMPPTYAHLPLLLNRDGTKLSKRQGDIFVQRFREQGVLPETLLDIVTHA
GSGFSDNWIGRRLDELVCKFNISKITTHSALLDLDKLDEFSRVHLQHRIEDEERCAVLRD
ELRQQVLHIHGSRISDCTVLEPHYMQRVLQLRKGHVCSLRELLNDTHTYLWIRPRVTRQQ
LQEVSAEVDDIAAAVIQLVASGGSFESTEHLNTELKLIASRLKHTKYSGGMRVLRLALSA
QQQGPSVAEMMLSLGEQEVCVRLQKALEH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttcagtgttttgaggaaagtgtgctggaggagaggcgtgtgcacgagacatcccgcg
cccgcgccgcgcgtccgcttcgctccgagtcccacagggtttctgcatctcgggggtctc
cgcacagcgctctataactatctgttcgccaagcagcgcggcggcaccttcatcctgcgg
ctggaggacactgaccagagccgcctgatacctggagctgcagacgatatagaggacatg
ctggagtgggcaggcatcccgccggacgagagccgccgtagaggagggggttatgggccg
tatgttcagtccgagcgactgcagctctactcgcaggcggcgtctgctctgctgcagacg
ggacacgcctattactgcttctgctccaatcagaggctggatctgctgaagagagaggcc
cagcgcagcggacaggtgccgcggtatgataaccgctgtcgagagctgccgccggagcag
gtgcagcagaagctggctcagggcattccgtgtgtgatccgcttcaagctggtctccggc
gcagaggtgttccaggacctggtcttcagctggacgcggcacgatccggcggcagcggag
ggagatccggtcatcctgaaggccgacggcttccccacctatcacctggccagcgtggtg
gacgaccacgctatgcgcatcagtcacgtgctacgcggctctgagtggctgatctccacc
gccaaacacctccagctgttccgcgcactgcgctggatgccgcccacttacgcacacctg
ccgctgctgctcaaccgcgatggtaccaagctgtccaagagacagggagacatcttcgtc
cagcgcttccgagagcagggcgtgctgcccgagaccctgctggacatcgtcactcacgcc
ggatccggcttcagtgataattggatcggtcggcgtttggatgaattagtttgcaagttt
aacatttccaagatcacgacgcactcggctctgctggatctggacaaactagacgagttc
agcagggttcatctgcagcacaggatcgaggatgaggagaggtgcgctgtgctgcgggat
gagctgcgtcagcaggttcttcacatacacggctctcggatcagcgactgcaccgtcctg
gagccgcactacatgcagagagtcctgcagctgcgcaagggtcacgtctgctctctgcga
gagctactcaatgacacgcatacatacctgtggatccggccgcgagtcacgcggcagcag
ctgcaggaagtgagcgcagaggtggatgacatcgcagcagcagtcatacagctggtggcg
tccggcggctcgttcgagtccacagagcatctgaacactgagctcaaactcatcgccagc
agactgaagcacaccaaatacagcggagggatgagagtgctgagactcgctctgagcgcg
caacagcagggtcccagtgtggcggagatgatgctttctctgggagaacaggaggtgtgt
gttcgccttcagaaagctctggaacactga

DBGET integrated database retrieval system