KEGG   Sinocyclocheilus anshuiensis: 107666662Help
Entry
107666662         CDS       T04917                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107666662
   04020 Calcium signaling pathway
    107666662
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sanh04040]
    107666662
Ion channels [BR:sanh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107666662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 107666662
NCBI-ProteinID: XP_016313568
Position
Unknown
AA seq 1544 aa AA seqDB search
GMYQPCENIDCSSKRCQILQAFDAFIYIFFALEMVVKMVALGIFGQRCYLGDTWNRLDFF
IVMAGVVEYSLDLQNINLTAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLC
FFVFFVFGIIGVQLWAGLLRNRCYPEENFTLSTGVALPAPYYSPSEEDERPFICSLPQDN
GIMSCSDVPARRVAGHQCCLEVDDLLHHQALGLVTEPFLNASAIAPGLCVNWNRYYTRCH
TGHRNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSF
FMINLCLVVIATQFSETKQREHQLMQEQRATCLSSSTLASLVEPSDCYEEIFQLVCHVLH
KARRRTAAFFRMLCRKPPEQMHMKTNINGGEKRFQQHDGATPSASAANQETEEEAAEEKD
RCMRAEGACRRRSRELWMEMRVKLQGIVESKYFNRGIMVAILINTISMGIEHHQQPEELT
NVLEICNIVFTSMFALEMILKLTAFGFFNYLRNPYNIFDGIIVIISVCEIVGQSDGGLSV
LRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFS
LKTDTGDTVPDRKNFDSLLWAIVTVFQGDANRSYSDDDDDEGSSSNGSEQHKNSLTFSDP
KLSSLTPNGHLDLAPLAEEKTRTDFSEENHRSRTICLGRRSSSLRHSRSSHYHHWGRPPP
QPSWSRRCSWNSVGRSARGLRAGGVIGGSLRVRSVHSNPAEHESLLPHPPFLSRRHRRAL
SLELPELLQCPPLVRKKSVSAEHQDCNGKGPGPQGTLLGEVYPQLNARKDKHDLEEDTEY
SLCFRIQKMMEVYRPDWCEKREDWSIYLFSPQNKFRLLCQTIIAHKLFDYVVLAFIFLSC
ITVALERPRIHQGSLERVFLTISNYVFTAIFVAEMTVKALMSLFVLASKDGWVNIMYHGL
DAVGIDQQPVINNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEARRRE
EKRLKRMEKRRRKAQRLPYYSSYGRVRRMIHSFCTSHYLDLFITLIICINVVTMSLEHYN
QPQSLETALKYCNYFFSSTFVVETMLKLVAFGFRRFLKDRWNQLDLAIVLLSVMGITLEE
IEISASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFVLLF
FIYAALGVELFGELVCNVEYPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRE
CPPGDSYSCNSSLQIISPMYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAE
IEMELAQGGLCCLGHPERSTGADAGERPSIHTNTNTSQSGFTQNQRRLYSSAQENQWLES
VSLLMKDSLDGEMQMIDNLSGSVFHHYCSPAIRRVGRSQSGEIRLAEVEQTSLMSEQLSD
KSSSPALPDDISLDEHSDRKEHGSADLSTGELVCRSVLPQSEACSPGRDRREERREMGHR
GDGCGGDGQMSSPLFHLPAEFFHPTTAAVPQGSPAIGAAQPGSR
NT seq 4632 nt NT seq  +upstreamnt  +downstreamnt
gggatgtaccagccctgcgagaacatcgactgctcctccaaacgctgccagatcctgcag
gccttcgatgcattcatctacatcttctttgcgctggagatggtggtgaagatggtggct
ctggggatcttcggccagcgctgttatctgggagacacctggaacagactggacttcttc
atcgtgatggccggggtggtggagtattctctggacctgcagaacatcaacctgacggcc
atccggacggtgagagtcctgcggccgctcaaagccatcaacagagtccccagcatgagg
atcctggtgaatctgctgctggacacgctgccgatgttggggaacgtgctgctgctgtgc
ttcttcgtcttcttcgtcttcggcatcatcggtgtgcagctctgggctggacttctgcgc
aaccgctgctatccggaggagaacttcaccctctcaacaggtgtggcactccctgctcca
tactactctcccagtgaggaggacgagaggcccttcatctgctctctgccacaggataat
ggcatcatgtcgtgcagtgacgtgccggcacggcgtgtggcgggacatcagtgctgtctg
gaagtagatgatctcctgcaccatcaggcactgggcctcgtgaccgagcctttcctcaat
gccagcgccatcgcccccggactctgtgtcaactggaatcgatactacacacgctgccac
accggacacagaaacccacacaaaggagccatcaactttgacaacatcggatacgcctgg
atcgttatatttcaggttattactctggagggctgggtggaaatcatgtattacgtcatg
gatgctcactcattctacaacttcatctactttattctgctgattatagtcggctcgttc
ttcatgataaacctgtgtttggtcgtcatagcgacacagttttcagagaccaaacagcgt
gagcatcagctgatgcaggagcagcgagccacctgtctgtcctctagcacgctggcctcg
ctggtcgaacccagcgactgctacgaagagatcttccagctcgtctgccatgtcctccac
aaggctcgcagacgcactgctgcctttttcaggatgctctgccgcaaaccaccggagcag
atgcatatgaaaacaaacatcaacggaggagaaaagcgcttccaacaacatgatggagcc
acaccttccgcctcagcagccaatcaggagacagaggaggaggcagccgaggagaaagac
aggtgcatgagggcagagggggcgtgtcggaggcggagcagagagctgtggatggagatg
agggtcaaactgcagggcatcgtggagagtaaatacttcaacagaggaatcatggtggcc
atcctcatcaacaccatcagcatgggcatagagcatcatcagcagccggaggagctcact
aatgttctggagatctgtaacatcgtcttcaccagtatgtttgctctggaaatgattctc
aagctcacagcattcggcttctttaattacctgcgcaatccgtacaacatctttgatggg
atcattgtgatcatcagcgtgtgtgagatcgtgggtcagtctgacggcggtctctcggtg
ctccgcaccttccgcttgctgcgggtcctgaagctggttcggttcatgccggcgctgcgc
agacagctggtggttctgatgaagaccatggacaatgtggccacattctgcatgctgctg
atgctcttcatcttcatcttcagtattttgggaatgcatatattcggctgcaagttcagt
ctgaagacagacactggagacacggtcccggacagaaagaactttgactctctgctgtgg
gcgatcgtcactgtgtttcagggtgatgccaatcgctcgtactctgatgatgatgatgat
gaaggatcttcctctaatggaagtgaacagcacaaaaactcgctcacgttctccgatccc
aagctgtcgtctctcactcctaatgggcatctggatctggcgccgctggcggaggagaag
accaggactgacttctccgaggaaaaccaccggagcagaaccatctgcctgggcaggaga
tcctcgtctctgcgccacagccgcagttcccattaccaccactgggggcgtcctccccct
cagccgtcctggagccggcggtgtagctggaacagcgtgggtcgctccgcccgtggcctg
agggccggaggggtcatcggggggagcttacgggtccgcagcgttcactcgaaccccgcc
gaacacgagtctctcctgccccacccgccattcctgtcgcgccgacaccgccgcgctcta
tcactcgagctgcctgagctcctgcagtgccccccgctggtccggaagaagagcgtgtct
gccgaacaccaggactgcaatgggaagggcccgggccctcaggggacgctgctgggagag
gtttatccacagctcaacgcacgcaaagacaagcacgacctggaggaagacacagaatat
agcctctgcttccgtatccagaagatgatggaggtctatcgtccggactggtgtgagaag
agagaggattggtccatttacttattctcccctcagaacaagtttcgtctgctgtgtcag
acgatcatcgctcataagctctttgactatgtggttctggctttcatcttcctcagctgc
atcacagtggctctggagagacccagaatccatcagggcagtctggagcgagtcttcctc
accatctccaactacgttttcactgccatctttgtggccgagatgaccgtcaaggctctg
atgtcactgtttgtgttggcgtctaaagatggttgggtaaatatcatgtaccacgggctg
gacgctgtcgggattgaccagcagcccgtcatcaataacaacccctggatgctgctgtac
ttcatctccttcctgctgatcgtcagtttcttcgtcttgaacatgtttgttggtgtggtg
gtggagaacttccacaagtgccggcagcatcaggaggtggaggaggcgcggcggagggag
gagaagcggctgaagcgcatggagaagaggaggcgcaaggcccagcggctgccgtattac
tcctcgtacggtcgcgttcggcggatgattcactcgttctgcaccagtcattatctggac
ctcttcatcaccctcatcatctgcatcaatgtggtcaccatgagcctggagcactacaac
caaccacagtcgttggagacggcgctgaaatactgcaactacttcttcagctccacgttt
gtggtggagaccatgctgaagctcgtcgcgttcggcttcagacgcttcttgaaagacaga
tggaatcagctggatctggccatcgtgctgctgtctgtgatgggaatcactctggaggag
attgaaataagcgcttcgctcccgatcaatcccaccatcatccgcatcatgagggtcctg
cgcatcgcccgcgttctgaagttgttgaagatggccacaggaatgagagcgctgctcgat
accgtggtgcaggcgttaccacaggtggggaatctgggtttgctctttgttctgctgttc
ttcatctatgctgcgctcggtgtcgagttgtttggagaactggtgtgtaatgttgaatac
ccgtgtgaaggcatgagtcgtcacgccacgtttgaaaacttcggcatggcgttcctcact
ctcttccaggtgtctacaggagataactggaacggcatcatgaaggacacgctgcgcgag
tgtccgccgggcgacagctactcgtgtaactccagcctgcagatcatctcgcccatgtac
ttcgtcagcttcgttctgacggctcagttcgtcctgattaacgtggtggtggccgtgctg
atgaagcacctggacgactccaataaagaggcgcaagaggacgcggagatggacgcggag
atcgagatggagctggcgcagggtggcctgtgctgtctggggcatccggagcgctcgacc
ggggccgatgcgggcgagaggccatcgattcacaccaacactaacaccagccagagcgga
ttcacacagaaccagaggagactctactcatcggcacaggagaaccagtggctggagagc
gtctctctgctgatgaaggactcgctggatggagaaatgcagatgattgataatctatca
ggatcggtgttccaccattactgctctccagcaatcagacgagtcggcaggagccaatca
ggagagatccggctggctgaggtcgagcaaacgtctctgatgtcggagcagctgtcagat
aaatcctcctcaccggcgctacctgatgacatcagcctggacgagcacagcgaccgtaag
gagcacggcagcgctgacctgagcacaggcgagctcgtgtgcagaagcgttcttcctcag
agcgaggcatgcagcccagggcgagacagacgggaagagcggcgtgagatggggcaccgc
ggagatggctgtggaggagacggccagatgtcttcacctctctttcatctcccggctgag
ttcttccaccccaccaccgctgcggttccccagggcagcccagccatcggagcggcccag
ccgggctccaga

DBGET integrated database retrieval system