KEGG   Sinocyclocheilus anshuiensis: 107666990Help
Entry
107666990         CDS       T04917                                 

Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein-like
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00030  Pentose phosphate pathway
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
Module
sanh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sanh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    107666990
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     107666990
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     107666990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N PP1
Motif
Other DBs
NCBI-GeneID: 107666990
NCBI-ProteinID: XP_016314030
Position
Unknown
AA seq 826 aa AA seqDB search
MCEIFSEFASTDFFYKHSKILLFLFLFKGWVCDITMLRIKWELLLMAIICWQRGHTDNHE
AKKRLGHATVVVVGGTGDLARKYLWQGFFQLYADQVGKGHTFSFYGGGLSPTEKGTPLLF
GILKELACPPELSAERCTLVKDQFLHLSKYHQLKTTEDYEKLSQQIKQQLGQEGMVEAGR
LFYLSVPAFAFADIAEKINKTCRPPSDAWLRVVLEKPFGHDLYSAQALYKKLSDQLKEKE
MYRIDHYLGKQVVSKILPFRKENKKLLDPIWNKHHIERIEIVLKETLDAKGRIQFYDQYG
VIRDVLQNHLTEVMTLMLMNLPANLSNSMEILQNKLNFLASLQHVDNSNAVVGQYQAYNG
EVQEELNKTKDYFSLTPTFAGVVIHVDNAQYEGIPIFMTSGKALDERVSYARVLFKNDVF
CIQDPNNVQCKSKQIIFYLGHGNLQYPAILISKNLFKPELVSSGDWKEVTEYKDVNVLGL
PLSDYYIQSPVTPREAYCELISHVFFGRKDSFISAEGLLASWAFWTPLLEGLSRVFPRVY
PGGEANGNLLNFQLQGHQVAFSHEAVVNVINPGAKDNFQVMQGKYRSSEMVSAWAQELVE
RLASDLLLAAEEAIREEGQFHLALSGGSSPVALLRALALNLYTFPWRNTHIWQVDERCVP
HTETGSNFRSIHDLLLLHIRIPYFNIHPMPVHLTQRLCVEEDGGPALYEKEINKHVNGSS
FHYILLGVGQDGHTASLFQDTKLENDEERLVILTESPIKPHQRMSLTFTAINRARRVGVL
IMGKSKHELVSQLSRIKGESSKYPITKVQPKTGTLIWYIDYDALLG
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaaatcttttcagaatttgcatcaacagattttttttacaaacattctaaaatc
ctgttatttttatttctttttaaagggtgggtgtgtgatattacaatgcttaggataaaa
tgggagctgctgctaatggccatcatatgctggcagagaggccacacagataatcatgag
gctaagaagagacttgggcatgcgactgtggtagttgtgggtggaacaggtgacttggcc
aggaagtacctgtggcaaggctttttccagctctatgctgaccaggtaggcaaaggacac
accttctcattttacggtgggggcctttcaccgaccgagaaggggacaccgctgctgttt
gggatcttgaaggagctggcttgtcctccggagctctctgcagagcgctgtactttggtc
aaagaccagttcctgcatctttccaaatatcaccagctgaagactactgaggactacgag
aagctcagccagcagatcaaacagcagctaggacaggagggtatggtcgaagcagggagg
ctcttctacctgtctgttccagctttcgcgtttgcagacattgcagagaagatcaacaag
acctgccgccccccatctgacgcatggctcagggtggtactggagaagccatttggtcac
gacctttacagtgctcaggccctttacaaaaaattgtcagaccagctgaaagaaaaggag
atgtacaggattgaccactatttagggaagcaggttgtctctaaaatactgccatttagg
aaagagaataagaaacttctagaccctatctggaacaagcaccatatcgaaagaatagaa
attgtattgaaggaaaccctggatgccaaaggccggattcagttttatgatcaatatggc
gtcatcagagacgtgctccaaaatcacctcacagaggtcatgacccttatgttgatgaac
cttcctgcaaacctgtccaacagcatggagatactacaaaacaagcttaatttcttggct
tcccttcaacacgtagataacagtaatgcggttgtaggtcagtaccaagcttacaatgga
gaggttcaggaagagctaaataaaacaaaggactacttcagcttgacccccacatttgct
ggtgtggttattcatgtcgacaatgcgcaatatgagggtatccccatatttatgacctca
ggcaaggcacttgatgaacgggtttcttatgcacgtgtgcttttcaaaaatgatgtattt
tgcatccaggatcccaacaatgttcagtgcaaatccaaacagatcatattttatctgggt
cacggaaacctgcagtaccctgcgattcttatcagcaagaacctgttcaagcccgaactg
gtaagcagcggtgactggaaggaggtcaccgaatacaaagatgtgaatgtcctggggtta
ccacttagtgactattacatccagtcaccggtcacacccagagaggcttattgcgagctg
atctcgcatgtcttctttggacgcaaggatagctttattagtgccgaaggactccttgct
tcctgggcgttttggactcccctccttgaaggcctgagtcgggtctttccacgggtgtat
ccaggtggcgaagccaatggaaacctgctaaactttcagctgcagggccatcaggttgct
tttagccatgaagccgtggtcaacgttatcaaccccggtgccaaagacaacttccaagtg
atgcaagggaagtaccgtagttctgaaatggtatctgcctgggcacaggaactggtggag
cgcttggcttcggatctactcctggctgctgaggaggccattcgtgaagaaggtcagttt
cacctggcgttgtctggtggctccagcccagtggcactgcttcgtgcactggccctgaac
ctctacacctttccgtggcgcaacactcacatatggcaagtggacgagcgttgtgtgcca
catacagaaacaggctccaacttccggtccattcacgatctcctgcttctgcatatccgc
ataccctacttcaacatccaccccatgcctgtgcatctcacccaacggttatgtgtggaa
gaggatggtggaccagcattatatgagaaggaaatcaataaacatgtcaatggctccagt
ttccactacatcctgctcggcgtaggccaggacggccacactgcctcattattccaggac
accaaattggaaaatgatgaggaacggttggtaattctgacagaaagccccattaaacca
caccagaggatgagtctcacattcacagctatcaatagggctcgaagggttggtgtttta
attatgggcaagagcaagcatgaacttgtcagtcaactcagccgaattaagggcgaatca
tccaagtatcccattaccaaagtacagccgaagaccggtactcttatatggtacattgac
tatgatgcattgttaggataa

DBGET integrated database retrieval system