KEGG   Sinocyclocheilus anshuiensis: 107667037Help
Entry
107667037         CDS       T04917                                 

Definition
(RefSeq) isotocin receptor-like
  KO
K04229  oxytocin receptor
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04020  Calcium signaling pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107667037
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107667037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sanh04030]
    107667037
G protein-coupled receptors [BR:sanh04030]
 Rhodopsin family
  Peptide
   Oxytocin
    107667037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 107667037
NCBI-ProteinID: XP_016314103
Position
Unknown
AA seq 382 aa AA seqDB search
MESLLKETIFWPFNDSWANSSKGNDSRGLNQTVNPLKRNDEVAKVEVTVLVLILLLALTG
NLCVLVAIQTSKHVQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDFLCRLVK
YLQVVGMFASTYMLVLMSIDRCLAIWQPLRSLRRRKDRFFVLASWIISLLFSLPQVYIFS
LREVGDGVFDCWGDFVQPWGAKAYVTWISLTIYIIPVAILSVCYGLISYKIWQNFKLKTR
RDQCLSLTPRPAKGTALSRVSSVKLISKAKIRTVKMTFVIVLVYIICWTPFFFVQMWSAW
DPMAPREAMAFIIAMLLASLNSCCNPWIYMFFAGHLFRDLMQRCLMASHCGCKRQWRSKS
HSGTGAMRSTSSQKSVMQSSTT
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgctgaaagaaacgattttctggcccttcaacgactcctgggcaaattca
agcaagggaaacgacagcagaggattgaaccaaaccgtaaaccctctgaagcgcaacgac
gaagtggcgaaagtcgaagtaaccgtcctggtgttgattttgctgctggcgctcaccggc
aacctgtgcgtccttgtggctatccagacgagtaaacacgttcagtcgcggatgtactat
tttatgaaacacttgagcatagctgacctggtggtggcggtttttcaagttctccctcaa
cttatctgggacatcacctttcgcttttatggaccagactttttgtgccgcctggtgaag
tacctacaggtggttggcatgtttgcatccacttacatgctcgtgctgatgtctatcgac
agatgtttggctatatggcagcctctgcgttccctgcgccgtcgaaaggaccgttttttc
gtgctggcctcttggattataagcctgctcttcagtttgccacaggtgtacatcttctcc
ctcagagaggtgggcgacggggtcttcgactgctggggggattttgttcagccctggggc
gcaaaggcttacgttacgtggattagtctcacaatctacatcattcctgtagccatttta
agcgtttgttatggacttataagttataaaatatggcaaaactttaagctgaagacccgg
cgcgaccagtgtctgtccttgaccccgcggccagccaagggcaccgctctctcccgcgtc
agcagcgtcaagttgatctccaaagctaagatcaggacggtgaaaatgacgtttgtgatc
gtcctggtttatatcatatgctggacgccgtttttcttcgtacagatgtggtccgcctgg
gatccaatggctccaagagaagctatggcgttcattattgcgatgcttctggccagtctc
aacagctgctgtaacccctggatctacatgtttttcgctggtcatctgttccgggatctc
atgcagcgctgtcttatggcatcacactgcggctgtaagaggcaatggagatctaagagc
cattcaggcacgggtgcaatgaggagcaccagcagtcagaagagtgtgatgcagtcctct
actacatga

DBGET integrated database retrieval system