KEGG   Sinocyclocheilus anshuiensis: 107669094Help
Entry
107669094         CDS       T04917                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107669094
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sanh04040]
    107669094
Ion channels [BR:sanh04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107669094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 107669094
NCBI-ProteinID: XP_016316691
Position
Unknown
AA seq 914 aa AA seqDB search
MQRSLTLLCTSFLGLCLGSSFPSNINIGGLFPTESHEYEVFRFALSHHQDIPKLVPQVDM
VKMGNSFSMTYAFCSQFSKGVYAIIGVYDRKTVNMLMSFCGALHVCFVTPSFPMENSNQF
VIQLRPELQDALVGVIEHYKWSGFVYMYSSDSGLSVLQKVLDTAAEHNWLVTSVNVETMT
EASFLKVFQDLDKKKEGQIIIDCELERLTSILKKIIELGKNVKSYHYILANLGFLDIDLT
EFKKSEANVTGFQLVNYADRNISRIVQQWMDFDNKDAKVPKRGLKYTGALTYDGVKVMST
AFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIEGLTGHIQFNEKGRRT
NYTVSVMELRPTGPKKVGYWNEDEKFVSTAAYMPGSNDTYGLQNRTYIVTTILESPYVML
KKNHEQFTGNDKYEGYCVELAAEIAKHVGYHYILKIVADGKYGARDPETMMWNGMVGELV
YGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMC
IVFAYIGVSVVLFLVSRFSPYEWHAEDCEEGAEQNPNQPSSSSAQPGQGQQNQNQQSQEQ
TNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVE
RMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVFEKMWSYMKSADPSVFVKTTD
EGVIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRNPVN
LAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAM
LVALVEFCYKSRTESHRMKQSINDAMRCSTLTRMSGNGSGGENGRIVTHDFPKAVQTLPC
MSHAASMGLGASGM
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcctcacactgctctgcaccagttttctgggattgtgcctcggttccagt
ttcccaagtaatatcaacataggagggttattcccaaccgaatcacacgaatatgaagtg
tttcggtttgcgctctcgcatcaccaggatatccctaaactggtacctcaagtggatatg
gtcaaaatggggaatagcttctccatgacatatgctttctgttcgcagttctccaaagga
gtgtacgccattatcggcgtgtacgacaggaaaactgtcaacatgttgatgtcgttctgc
ggtgcgctacacgtctgcttcgtgacgcccagcttccccatggaaaactccaaccagttt
gtcatccagctgagacccgaactgcaggatgccctggtgggcgtaatcgagcactacaag
tggtctgggttcgtctacatgtacagctcggactctggactgtcagttctgcagaaggtt
ctggacacagcagcggagcataactggctggtgacctccgtgaatgttgagacaatgaca
gaagcgtccttcctcaaagtgttccaggacctggacaaaaagaaggagggccagatcatc
atcgactgtgagctggagagactcacctccatcctgaagaagatcatcgagttggggaag
aatgtgaagagctaccactacatactagcaaacctggggtttctggacatcgacctgaca
gagtttaagaagagtgaggcgaatgtaacaggcttccagctggtgaactatgcagaccgt
aacatcagtaggatagtgcagcagtggatggactttgacaacaaagacgccaaagttccc
aagcgaggactgaagtacactggagctctcacatatgatggagtcaaagtcatgtccaca
gccttccagaacctccgtaggcagaggatagatatatctcgccgtggaaatgctggagaa
tgtctggccaacccaccagcaccttggggccaaggcatcgatattcagagagcacttcag
caggttcggattgaaggcctaacgggacacattcagtttaacgaaaaaggacgaaggaca
aactacactgtcagtgtgatggagctcaggccgacaggaccgaaaaaagtgggttactgg
aatgaggatgagaaatttgtgagcacggcggcctacatgccaggcagtaatgacacttac
ggacttcagaatcgcacatatattgttaccactattctggaatcaccgtatgtcatgctg
aaaaagaaccacgagcagtttactggaaatgataagtatgaaggttactgtgtggaactg
gcagctgagatagccaaacacgtgggataccactacatactcaagatagtggctgatggg
aaatatggagccagagatcctgagaccatgatgtggaatgggatggtgggagagctcgtc
tatggtaaagctgacgtagctgtggccccactgaccatcaccctggtcagggaggaagtc
attgatttctccaagcccttcatgagcctcggcatctccatcatgatcaaaaagcccacc
aagtccaagcctggtgtgttctccttcctggaccctttggcctatgagatctggatgtgt
attgtgttcgcctacatcggtgtgagcgtggtgcttttcctagtcagccgcttcagtccc
tacgagtggcacgcagaggactgcgaggaaggagcagagcagaaccctaaccaaccctcc
tcgtcgtccgctcaaccgggtcagggccagcagaaccagaaccagcagagtcaggagcag
accaacgagtttggtatcttcaacagtctctggttttcattgggtgctttcatgcagcaa
ggctgtgatatttcccccaggtctctctctggccgtatcgtgggtggtgtgtggtggttc
ttcactctgatcatcatttcctcatacacagccaacctagctgcttttctcacagtggag
aggatggtgtcacccatcgagagtgcagaggatctggccaaacagactgagattgcgtat
gggactctagatgccggctccaccaaagagttcttcaggagatcaaagatcgcagtcttt
gagaagatgtggtcttatatgaagtctgcagacccctcagtgtttgtgaaaaccacagat
gaaggagttatacgggtgaggaaatccaaagggaagtatgcctacctgctggagtccacc
atgaacgagtacatcgagcagcgcaaaccctgtgacactatgaaggtcggaggaaacctg
gactccaaaggctatggcatcgccacccccaaaggatcccctctcagaaacccagtaaac
ctggcagtgttaaaactgaatgaacaaggcctgttggacaaattgaaaaacaaatggtgg
tacgacaagggagagtgtggcagcggaggaggtgattccaaggacaagaccagtgctctt
agcctcagcaatgtggctggggttttctacattctgatcggtggtctgggtctggccatg
ctggtggccctggtggagttctgctacaagtccagaacagagtcccacagaatgaagcaa
tccatcaatgacgccatgcgctgctccacgctgaccaggatgagtgggaatggtagcggc
ggggagaacgggcggattgtcacacatgacttccccaaagctgtgcagacgctgccgtgc
atgagccacgcggcgagcatgggcctgggagcctctggcatgtga

DBGET integrated database retrieval system