KEGG   Sinocyclocheilus anshuiensis: 107669175Help
Entry
107669175         CDS       T04917                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00010  Glycolysis / Gluconeogenesis
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107669175
   00562 Inositol phosphate metabolism
    107669175
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107669175
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107669175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107669175
NCBI-ProteinID: XP_016316791
Position
Unknown
AA seq 457 aa AA seqDB search
MKTTYFLANFLITSLSIMVGLSLSKLARPIPAIAHHFGTKGRYEEVNPHLLDDILFVNKS
LVAPPSPDCRAIHMVSVIRHGTRYPTTKNVKKIARLFDLVVSHASGSASWLNDIKTWKMW
YTEDMDGRLVEKGRDDHRHLAMRLAQSFPTLISEDHLRANRIEFITSSKHRCVDSVKAFQ
EGLHRLWDVQDMDYKHYVDDSLMRFFDHCERFVESVEKNKTALKEVERFKSSAEMDAVRR
KISSRLQIPYSQFTPDMAEASFFLCSYEFAIKSENSPWCDLLDESDAQVLEYKNDLKQYW
KRGYGHDVNRKSSCPLFHDIFKRLEKAANDYRFGEVKKTATIQVGHGETLLPLLSLMSFY
KDEKPLTAENFSLQHNRTFRSSQIVPYAANLVFVLYECSDGLRIQLFLNEKLMTFPNMNH
SAPLYETVRKHYSKLLNGCEFNKECNVPQSNLRNTEL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacttacttcctcgcgaactttcttatcacttctttgagcattatggttggt
ttgtcattatctaaacttgccaggccaataccggcgatagcgcatcactttgggacaaaa
ggcaggtacgaggaagtgaacccacatctattagatgacattttgtttgtaaacaaatca
ctggtagctcccccctctccagattgccgtgccattcatatggtgtctgttatccgtcac
gggacgcgctatccaaccaccaaaaatgtgaaaaagatcgcgcgattgtttgatctggtc
gtgtctcacgcgtcgggttcagcctcatggctaaatgacattaagacatggaagatgtgg
tacactgaagacatggacggcagactggtggagaaagggcgcgatgaccacaggcatttg
gctatgagactggcacagtcgttccccactttgatttctgaggatcatctccgtgccaac
cgcattgagttcatcaccagctccaagcatcgctgtgttgatagtgtcaaagcttttcaa
gagggtcttcaccgactctgggatgttcaggatatggattacaaacactatgtggatgat
tcactcatgagattctttgaccattgcgagagatttgttgaaagtgttgagaaaaacaaa
acagctttgaaggaggtagaacgctttaaatcttcagcagaaatggatgcagtacggagg
aaaatatccagtcgccttcagattccatacagtcaattcaccccagatatggcagaggca
tctttctttttgtgttcctatgagtttgccatcaaatcagagaactccccttggtgtgat
ctgctggatgagtctgacgctcaagtcctggagtacaaaaatgacctgaaacagtactgg
aagaggggatatggacatgacgtcaaccgtaaatccagctgccctctctttcatgatatt
ttcaagcgtcttgaaaaggctgctaatgactacagatttggagaggtaaaaaagactgcc
accatccaggttggacatggtgaaaccctgctgcctctgctctctctgatgtccttctat
aaggatgaaaaacctttaactgcagagaatttttcattgcagcacaaccgcacattccgc
tccagtcagattgtaccttatgctgcaaacttagtctttgtcctgtacgaatgcagtgat
ggactcagaatacagttgtttctcaatgagaagttaatgacctttcccaacatgaaccat
tcggctccactgtatgaaacggtcagaaagcattactcaaagctccttaatggctgtgag
tttaataaggaatgtaatgtgcctcagtcaaacctcaggaacactgaactttga

DBGET integrated database retrieval system