KEGG   Sinocyclocheilus anshuiensis: 107669686Help
Entry
107669686         CDS       T04917                                 

Definition
(RefSeq) gamma-glutamyltransferase 7-like
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00430  Taurine and hypotaurine metabolism
sanh00480  Glutathione metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    107669686
   00480 Glutathione metabolism
    107669686
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sanh01002]
    107669686
Enzymes [BR:sanh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     107669686
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     107669686
Peptidases and inhibitors [BR:sanh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   107669686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 107669686
NCBI-ProteinID: XP_016317521
Position
Unknown
AA seq 567 aa AA seqDB search
MYSPAADTGVTVVEKDAALSSAYSPVDYMSITSFPRLPEDEVSADNILKSRKDNDNFLSE
QDTDPDLFLKTARLQQLPSSASDLASQDISPLRETSRDPLAQDCACTRDGLTVIITACLT
FATGVTVALIMQIYFGDPQVYNQGAVVTDVARCTSLGFDVLGKRGSSVDAAIAASLCLGI
IHPHTSGIGGGGVMLVHDIRRNESRVIDFRETAPSGIHKNLMLHVNQRSGLLVAVPGMIS
GLHQAHQLYGRMLWKDVITMAADVARTGFNVTHELADALSEVKEQNVSDAFRDLFLPNGQ
APLAGLFTKRLDLAAVLDRIAANGVSEFYSGNLTQEMTSVVHAKEGVLREDDFKNYTTVI
QKPLQSLYQGYRVLVPPPPQAGAALLSALNILEGFNITNQVSRSSVYHWIAESLKIALSQ
ASGLGDSVFNSSVSELVTQMLSKDQAAVFRQKISDSQASAAEHYTPSYELQEGAVASQLM
IMGTDDLIVSVMSSLNRPFGSRIVTPSGILLNSQMLDFSWPNKTHSFAAVNLVLLNNFDN
FCQKPFPLSKTLPPEGMSAKPNVQNEE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtactctccggcagccgatacgggagtgacggtggttgagaaggatgcggctctgagc
agcgcgtactcacctgtggactacatgagcatcaccagcttccctagactaccagaagat
gaagtttcagccgacaacatcctcaaatcacgcaaagacaatgataacttcctcagtgag
caggacacagaccctgatctattcctgaagacggcccgactgcagcagctgccctcctct
gcctcagacttggccagtcaggacatctctcctctgagagagaccagcagagacccgctg
gcgcaggactgcgcctgcacacgtgacgggctgaccgtcatcatcaccgcctgcctgacc
ttcgccacaggggtcaccgtggccctcataatgcagatctactttggagacccacaggtg
tataatcaaggcgcggtggtgacggatgtggcccgctgcacgtctctgggctttgacgtt
ttgggcaaacgggggtccagcgttgatgctgctatagctgcttccctctgcctgggcatc
atccatccccacacctcgggcatcggcggtggtggcgtgatgctggtccatgacatccgc
aggaatgagagccgggtcattgacttccgcgagacggcaccctctggcattcacaagaac
ttgatgttacatgttaatcaaaggtcaggtctgttagtggctgttcccggcatgatcagt
ggactacaccaagctcatcagctctatggaagaatgctgtggaaggacgtcatcacgatg
gctgccgatgtggcgaggactggattcaatgtgacgcatgagctggctgatgcgctgtct
gaagtgaaggagcagaatgtgtcggatgcattcagagatctgttcctgccgaacggtcag
gctcccctcgcaggactcttcactaaacgtctggatttagctgccgttctggacaggatt
gcagccaatggagtctcagagttctacagtgggaatctgactcaggaaatgacatcagtg
gttcatgctaaagaaggtgtgctgagagaggatgacttcaaaaactacaccactgtcata
cagaagccactgcaaagtctttaccagggctaccgggtgttagttcctcctccgccccaa
gcgggagccgccctgctgtccgctctcaacatcctggagggatttaacatcacaaaccag
gtgtccaggagcagcgtttaccactggatagctgagtctctgaagattgctttgtctcaa
gccagtggactgggagactccgtgttcaattcatcggtttctgagttggtgacgcagatg
ctcagtaaagaccaggctgctgtgttccggcagaagatcagtgattcgcaggcgtctgcg
gctgagcactacacgccgtcatacgagctgcaggagggcgctgtggccagccagctcatg
atcatgggcactgatgacttgatcgtgtctgttatgagctctctaaaccggccgtttgga
agtcgcattgtgacgccctctgggatcctcctaaacagccagatgctggacttctcttgg
cccaacaaaacccacagctttgcagctgtcaatctggtgctcttaaacaattttgataac
ttctgccaaaagcctttccctctctccaaaactcttccccccgaaggcatgtcagcaaag
cccaatgtgcaaaatgaagaatga

DBGET integrated database retrieval system