KEGG   Sinocyclocheilus anshuiensis: 107673025Help
Entry
107673025         CDS       T04917                                 

Definition
(RefSeq) glucosylceramidase-like isoform X1
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00511  Other glycan degradation
sanh00600  Sphingolipid metabolism
sanh01100  Metabolic pathways
sanh04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107673025
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107673025
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107673025
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107673025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 CAP Glycoamylase
Motif
Other DBs
NCBI-GeneID: 107673025
NCBI-ProteinID: XP_016321929
Position
Unknown
AA seq 527 aa AA seqDB search
MQQESPLHLVDRMRETVLFILLTGVIAIARADDCRALNFGHGSVVCLCNATYCDSVGRTG
LPYPGQFLSYVSSKAGSRLVKSRGQFQKNSTGAALRITLNPSQKYQRIKGFGGAMTDAAA
MNILSLSSGAQDQLLRQYFSPDGIEYRFVRVPMASCDFSTRLYTYADTPDDYSLQNFTLT
EEDIHMKIPLLQRAQALSAQPLNLFASAWSGPAWLKTNGALIGKGSLKGKPGGKEHKTWA
QYYIRFLEEYGKYNLSFWGLTSGNEPTAGEMTNYSFQALGFTPETQRNWIALDLGPGLHS
SSFPQTRLMILDDNRLLLPHWAKVVLSDVQAARYVHGIGFHWYLNNLAPPDFTLTATHHL
YPEYFLFATEACSGWNPLDRGVRLGSWDRAEDYAHDIIQDLNNYVTGWTDWNLALNQDGG
PNWVKNFVDSPIIVDPSKDVFYKQPTFYSMAHFSKFLWEGSQRVGVSYSQHTSMEISVYI
RPDASAVLIVLNRSEEEMQFEVWDQTLGFLSERAPAHSILTLLWSRR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagaatctccactgcatctcgtcgacagaatgagagaaacggttcttttcatt
ctgctgactggagtaatcgctatagcaagagctgacgactgtcgagcactgaatttcggt
catggttcggttgtgtgcttgtgcaatgcgacatactgcgactcggtgggccgcactggg
ttgccatatcccggtcagtttttgtcttatgtcagcagtaaagctggcagcagactcgta
aagagtcgaggccagtttcagaagaacagcacaggtgcagctctcagaatcactctgaat
cccagtcagaagtatcagcgcattaaaggattcgggggagccatgacagatgcagcagcc
atgaatattctgtccctgtcctctggagctcaggaccagctgctcagacagtacttctcc
ccagatggtatagagtaccgtttcgtgagagtgccgatggccagttgtgatttctcaact
cgcctctacacatatgctgacactccagacgactacagtctccagaacttcacgctgact
gaagaggatattcacatgaagattcccctgctgcagcgggcacaggctctctctgctcag
cctctcaatctatttgccagtgcctggagcggccccgcctggctgaagaccaatggtgca
ctgattggcaaaggctccctcaaaggcaagccaggaggcaaagagcataagacctgggct
cagtactacattagatttctagaggagtatggaaaatataatctttcattctgggggttg
acatcaggaaacgagcccactgcaggcgaaatgacaaattacagttttcaggctttgggt
tttactccggagacacagcgcaactggattgccctggatctgggtccaggactccattcc
tcatcctttccccaaactcgccttatgatccttgatgacaaccgacttctgcttccacac
tgggccaaagtggttctgagtgacgtacaagcagcacgttatgtacacgggattggtttt
cactggtatctgaacaaccttgcgccacctgacttcaccctgacagccacacaccacctc
tacccagagtacttcctgtttgcaacagaggcgtgttctgggtggaatccgctggatcgt
ggggtgcgtctgggcagctgggacagagcagaagactatgcacatgacatcatacaggac
ctgaataactatgtgacaggctggacagactggaacttggcccttaatcaggatggaggg
ccaaattgggttaagaactttgtggacagccctattattgtggacccaagtaaagacgtc
ttctacaagcagcccaccttctacagcatggcccacttcagcaagttcctgtgggagggg
tcacagagagtgggcgtgtcctacagtcagcacaccagcatggaaatttctgtctatatc
agacctgatgcttcagccgtgttaatcgttctcaacaggtctgaagaagagatgcagttt
gaggtttgggatcaaacgctgggctttttgtcagaaagagctccagctcactccatcctc
accctactgtggagcagacgctga

DBGET integrated database retrieval system