KEGG   Sinocyclocheilus anshuiensis: 107673365
Entry
107673365         CDS       T04917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sanh01002]
    107673365
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107673365
Peptidases and inhibitors [BR:sanh01002]
 Metallo peptidases
  Family M1
   107673365
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Glyco_transf_11
Other DBs
NCBI-GeneID: 107673365
NCBI-ProteinID: XP_016322402
Position
Unknown
AA seq 939 aa
MTSFALLVNLIVLPIHLWAAVTPETTSFPTSTNGEPFPWNKIRLPDTASPLHYHLLIHPN
LTSLDFTGMVQIQIEVHENTKNIILHSKDLHISNARLLDSDIGQIQALKVLEYPYFQQIA
LISEHALLKRDHVYSIQLEFAASLSESFHGFYKSTYRTSKGDLRVVASTQFEPTSARAAF
PCFDEPAFKANFSVRIRREAKHIALSNMPKLRTLELPGGLFEDQFDVSVKMSTYLVAFIV
SDFLSISKTSQHGVQISVYAVPEKIDQAEFALDAAVKLLDFYDDYFDIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESGLLFDPHKSSASDKLGITMIIAHELAHQWFGNLVTMQWWND
LWLNEGFAKFMEFVSVNITNPELQVEDYFLEKCFVAMEVDSLSSSHPVSTPVENPAQIQE
MFDDVSYDKGACILNMLREFLTPDAFKLGIVRYLKRXSYQNTVNSNLWESLTNVCDSDGL
DEGRLKGDESCRHSVSHSGASKWHSEDELDVKAMMETWTLQEGFPLITVEVKGREVQLSQ
ERYLKSDDPSQTSSFLWHVPLTYITSGSATVHRFLLKTKTDVLHLPEEVDWIKFNVDMSG
YYIVHYEGSGWDDLITLLKHNHTVLSSNDRASLINNAFQLVSVGKLPLDKALDLTLYLSK
ETEIMPVTQGFSELVPLYKLMEKRDMVELENQMKGYILQLFRKLIDQQSCTDDGXTQRML
RSYLLLFGCVRGHPPCVSTATQLFNRWRDSDGNMSLPNDVTLAVFSVGARTEDGWEFLFE
KYKESMYVSMKSRIKMALTTSPLDHKLKWMMEQSLVGEVMKTQDLPYVVTSVSINPKAYK
HAWDFLKANWDSMIKKFDLGSPSIAHMVVGVTNQYSTREMLAEIRSFFSSLRAETGAELR
CIQQALENIEENIRWMDKNLPLLKAWLHRHYDQQKNTEL
NT seq 2820 nt   +upstreamnt  +downstreamnt
atgactagctttgctctgcttgtgaatctcatagttttgcccattcacctctgggctgca
gtcactccagagaccacttcattccccacatcaaccaatggagaaccattcccatggaac
aaaataagacttccagacacagcatctcctcttcattaccatctccttatccaccccaac
ctcacaagtttagactttaccggaatggtgcagatccaaattgaggtccacgaaaacacc
aagaatatcatattgcacagcaaggatcttcatatctccaatgcaaggttgctagattca
gacataggtcagatacaggccctaaaggtgctggagtacccatacttccagcagattgca
cttatatctgagcatgcactgctgaagagagaccatgtatattcaattcaactggagttt
gccgccagcctctctgagagctttcatggattttacaaaagcacgtatcggaccagcaag
ggagacctcagggttgtggcttccacacagtttgagccgactagtgcccgggcagctttt
ccctgttttgatgaacctgccttcaaagccaacttttccgtgcggattcgcagagaagca
aagcatattgccctctcaaacatgcctaagctgagaacattagagctgccaggcggcctg
tttgaggaccagtttgatgtgagtgttaagatgagcacatacctggtggccttcattgtc
tctgactttctgtccatcagcaaaacgagtcagcatggagtccagatttcagtgtatgct
gtgccagagaagatcgaccaggcagagtttgctctggacgctgcagtgaaactgcttgac
ttctatgatgactactttgacattccttaccctctacctaaacaagatcttgctgccatc
ccagactttcagtctggagcgatggagaattggggtctgaccacctaccgggaatcaggc
cttctttttgacccccacaagtcttctgcttctgacaagctgggcatcacgatgatcatc
gcccatgaactggcccatcagtggtttggaaacctggtgaccatgcagtggtggaatgat
ctgtggctgaacgaaggttttgccaagttcatggagtttgtgtctgtcaacatcaccaat
cctgaactgcaagttgaggattatttcctagagaagtgttttgtggccatggaggtagac
tccttgagctcctctcacccagtgtccacaccggtggagaatcctgctcagatacaggaa
atgtttgatgatgtttcctatgacaagggggcttgtattctgaacatgctgagagagttt
ctgaccccagatgcgtttaaactgggcattgtgagatacctaaaacgcnntagttaccag
aatacggtcaatagtaacctgtgggaaagtctgaccaatgtgtgtgactctgatggtctg
gatgaaggaagactgaagggtgatgagtcctgccggcactcagtctcacactctggagct
tctaaatggcactctgaggatgagctggatgttaaggctatgatggagacgtggacattg
caggagggctttccactcattacggtggaggtcaaaggtcgcgaagtccaattaagtcaa
gagcgttacctaaagagtgatgacccctcacaaacatccagcttcctgtggcacgttccg
ttgacttacattaccagcggctcagccacagtgcaccgcttcctgcttaagaccaaaaca
gatgttctgcatctgccggaggaggtggactggatcaagtttaatgtggacatgagtgga
tattacattgtgcactatgagggttctggctgggatgacctcatcacgctgctcaaacac
aatcacacagtgctcagcagcaatgaccgggccagcctcatcaacaacgccttccagctg
gtcagtgttggtaagcttccactggataaggctttagacctgaccctgtacctaagcaag
gaaactgagattatgccagtgacacagggcttcagtgagcttgtgcctctgtacaaactg
atggagaagagggacatggtggagctggagaaccagatgaagggctacatactgcagctg
tttaggaagctcatagaccagcagtcgtgtactgatgatggtnggactcagaggatgctg
cgcagctacctgctcctgttcggctgtgtgcggggtcatcctccctgtgtcagcacggct
acccagctcttcaaccggtggagggactcagatgggaatatgagtcttcctaatgatgtt
actttggctgtgttttctgtcggtgcccggactgaggatggctgggaattcctgtttgag
aagtacaaggaatccatgtacgtctccatgaagagcaggataaagatggcactcacaacc
agccctctcgatcacaagctaaaatggatgatggagcagagtctggtgggagaggtgatg
aagactcaggatctgccatatgttgtgacttcagtcagtataaatcctaaggcctacaaa
cacgcatgggactttttaaaagctaactgggactccatgattaagaagtttgatcttggc
tcaccctctatagcgcacatggtagtgggagtgaccaaccagtattccaccagagaaatg
ctagctgagattcgtagtttcttcagttccttgcgggctgaaaccggagcagaattgaga
tgtattcagcaagccctggagaacattgaagagaacattcgctggatggacaagaacctc
ccactactgaaggcctggctgcacagacattatgaccagcagaaaaatacagagctgtga

DBGET integrated database retrieval system