KEGG   Sinocyclocheilus anshuiensis: 107673592Help
Entry
107673592         CDS       T04917                                 

Definition
(RefSeq) separin-like
  KO
K02365  separase [EC:3.4.22.49]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04110  Cell cycle
sanh04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107673592
   04114 Oocyte meiosis
    107673592
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sanh01002]
    107673592
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107673592
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     107673592
Peptidases and inhibitors [BR:sanh01002]
 Cysteine peptidases
  Family C50: separase family
   107673592
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    107673592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 TPR_12 CHAT
Motif
Other DBs
NCBI-GeneID: 107673592
NCBI-ProteinID: XP_016322715
Position
Unknown
AA seq 2174 aa AA seqDB search
MKCLRTEEYVQQLSCVKDTVVLHEELKTHVDDGFGPYGRTMCDRIIRACNQRLGSGTLDP
AHQEKIVELVELAVQAFESLEESGMQSNPFYLEKIVFHILQKVTSLGAHSPACRLGQLMY
RRLKRLSAETDDFHVLVRNCFAVLWNSLQSNRASGSTLLPRDRLHCQLQALTFKLLEQGS
SSASFPSKVPLFVEEAVVEYERSCGGFTHDDVSFLSSELRELFFSPLINPQDSALTCLSL
AVQCEVVFKVCKLLCKSLFSAEAVGLLSGALEGVDRHVGLRSALSLADHAVQLQSALSLG
GECSKAFTESAHSLRGLPRSMSAAESHALLEACQLVVWAMEAGQCKGMDVTTLLACLSFL
EEYQELLLTQQKDSFSQQVQYSLCFSFYQGFIITYDSLHASQVSAVDALDRVLLYCQTTA
GRMLAELRTLNNDNFLLKAVCAVNNVVYELFNRKLYEGAFGLAVIVCQELCKDCPPSLPV
DRVNRCFMLTVQCSRRGGQLERALDWIVRWIQVLGTQILDHFAEPVSLWVKTKCDAARAG
EDDTRLRTLRDGLGEAIADEKVMMCLSEEELRLYKEQTGDTAQERYNTLCDLLDICHEET
PHTLRRATYLCEMAQVVCYQDFSQQTDCSAVDFTHEALRLLDSEPETAENADRLMDEKAH
ASLWLYICTLETNLQEAVDTEKRLRAVQEENKMEMNMDPVPTNDLEYEDKQKSQESQLVY
DGLCFNLLAQSKLSEPLDRCLSLWRSLLKGSVPAVRDPKLTASSMTLMAALYTLMGKHLQ
ALEGYQLATALFRSLGDAQNSANAFCQSARILLYLGSPQLAQVELEKAEQSLTSVPSSEG
TSVISMLAMLQKAQIHYALGQVERGVCCLMEVIKESAQHHSKSWYLLRARTLQTASEYLS
LDTETLDSQLRQSITQHGLKTPDTAQYEGLKLLCSLVMMLLGNGFYGAPGPNTDTHFVDQ
GDSVVFKWLLLSEVLVSSERMVTVRSSSGAVHEAKAQCLEALKLATKLQTLSHCAELLVL
KAELELMKGANEASSLDLDQVRNLLDLCTDFGQGRQQKSEVKIKPRKGRPAAPSSSGHTP
EEDDDLSGILSSRALLKEPVETMSRLGSQGASPPLKPKRQHVLSCLTHADSCSCPCCSEL
SVARVSIHWALLQADLQTDPEHSRRLRQYARKRCRSVAAKLQNSLAALMSSKKSTGLCLS
LLKVEQGKVHLGAVLQLLSTGDKGKATVLWEEIGAGLEVVTPKEALTPELGPIRAALLGA
KAVACCLALAMKKQCAPEELFSSVWGWNPPKIKPKTESKHRSKSPVSDTTPPETGAKCRH
DMKSASAEQESRKTKESSVVPKKPKDLVPKINITKSSMVFKTPKATRTSRPKSVSTSSGI
GDLRAFDFTNEVPEISVNFTHSLHPSASHRGIAKSKTGPKGSFEVYKDSSPAEEKPVIVP
AAPKRTKRSRFKVEFSDESDTEAAPVVEKSEKKKNASISKTSRILKPALNSIPSDLVNPT
VEPEPPRRTRTTKKSTALSSTSCLSPEEETGLSSQTRTRRGRPKKSQSSEATEEPERMRM
IKEDDEVLLNISLEELRGSDTEINDTGSPDADCEVLRRDLAADVGRECFSELRRNGSHTT
LPHASTPLADLSVEAVQSYLRSSWLLLHHFPPPSLFPHICSLLAQSLGQTDPITTAMLHA
QSLGVSTRHHMTRHVVSQFRKLKKSCNDVAEGLGALSLEETSGATQSQKLSALEQIFSFT
SSHPTQFPQTHCQQFTQQLKDLPAGITVCMLSLTGVYPDEIGSTILLTRLERGSTPITVR
IPTADRKRSVAVLLEEMDRVLKGQKEVSTVAEKSQWWEGRKALDARVEKMLEEMEEALRV
WRTLLLPLSSDPELEVQVKCFQKALKGTKITQDILKMVLSASPLLSLPDLQCLVEGMGQQ
DKDFLRLLQGGMTELSGREEPKGHTVLILDKFLQRLPWENIACLKSRSVTRMPSLHAVLG
HGHLKEMDSSCVLSCGVNPKKVYYVLNPDRNLPDTENRFKEWFTNERAWQGVCGTAPDPD
KLQEAVTTKDLYIYIGHGAGARFLDAQRVLKGPVQAVALLFGCSSAALSVLGHQEGTGII
LSYLTAGCPLVLGNLWDVTDRDLDRFTSALLQSWLSAGSGSSLLQHLTQSRNATHLKHII
GAAPIAYGLPAYIH
NT seq 6525 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttgagaacagaggagtacgtccagcagttatcatgtgtaaaggacactgta
gttcttcacgaagagctgaagacacatgtggatgatggctttggtccatatggtcgcaca
atgtgcgatcgtatcatccgggcttgtaaccagcgactgggcagtgggactctggaccct
gcccatcaggagaagatagtggagttggtggaactggccgtccaagcttttgaatcgctc
gaggagtcaggaatgcagagcaacccattttatcttgaaaaaatagtgttccacatccta
cagaaagtcaccagccttggagctcacagccctgcttgtcgattgggccaacttatgtat
agaagactaaagcgtttgtctgcagagacagatgacttccatgttctggtgcggaattgc
ttcgcagtgctgtggaacagtctccagtccaacagagcgagtggttccaccctccttccg
cgggacaggcttcactgtcagctgcaagctttaactttcaaactcctagaacaggggtcc
agctcggcctcttttccatctaaagttcctctgtttgtagaagaagcagttgtagaatat
gaacgatcttgtggtggttttactcatgacgatgtgagttttctgtcctctgaactacga
gaactgttcttcagccctttaatcaatccgcaggactctgcactgacatgtctctcacta
gcagtgcagtgtgaggtggtgtttaaggtttgtaaactgctctgcaagagtctgttttca
gccgaggctgttggactgttaagtggtgctttggagggtgttgatagacacgtgggtctg
cgttcggctttgagccttgcagatcatgcagtgcagctgcagagtgcgttaagcttggga
ggtgaatgcagcaaggctttcactgaaagtgcacattccctcagggggctgccccgttcc
atgtcggccgcagagtctcatgccctattagaggcttgtcagctggtggtttgggcgatg
gaagctggtcagtgtaaaggcatggacgtaactacattgctggcttgcttatcatttttg
gaagaatatcaggaacttctgctcacacagcaaaaagactcattttcacagcaggtgcag
tactcgctttgtttcagtttttaccagggcttcattatcacatacgatagtcttcatgca
tctcaggtgtctgcggtcgatgctctggacagagtgctgttgtactgccagacgacagca
ggacggatgcttgctgaactgcggacactcaacaatgacaatttcttacttaaagcagtg
tgtgcagtgaataatgtggtgtatgagctgtttaacaggaagctgtatgagggagccttt
ggtttggctgtgattgtgtgtcaggagctgtgtaaggactgcccaccctctcttcctgtg
gatagggtcaaccgctgtttcatgctgacagtgcagtgtagccggcgtgggggtcagctg
gagcgggctctagattggattgtgcgctggattcaggttttgggaacacagattttggat
catttcgcagaacctgtctcgctgtgggtcaaaaccaagtgtgatgctgcccgagcagga
gaggatgacacacgtctaaggactctgagggatgggttgggagaagcaatagcggatgag
aaggtgatgatgtgtttgtcagaagaggagttgcgtttgtataaagagcagactggagac
acagcccaggagcgctacaacacactctgtgacctcttggatatctgccatgaagaaacc
ccacacacactgagacgggcaacttatctgtgtgagatggcacaggttgtgtgctatcag
gacttcagccaacagactgactgctcagcagttgacttcacccatgaggcattgaggttg
ctggattcggagccagagacagcagagaatgccgataggttgatggatgagaaggcacac
gcctccctgtggctctacatctgtactcttgagaccaacctgcaggaggctgtggacaca
gagaagcgattgcgtgcagtgcaggaggagaataaaatggagatgaatatggatcctgtt
cccactaatgatctggagtatgaagacaaacagaaatcacaagagagccagttagtctat
gatggactatgcttcaatctactagctcaaagcaagctgagtgagcctttggacagatgt
ttgtctctgtggcggagtctgctcaaggggtctgtgcctgcagttagagaccctaaactc
actgcttcttccatgacattgatggctgccctctacactcttatgggcaaacacctgcaa
gctctggagggatatcagctcgctactgcccttttccgtagcctcggcgatgcccagaat
agtgcaaatgccttttgccaatctgccaggattttgctgtatctgggctctcctcagctt
gcacaggtggagttagaaaaagcagagcagagtttgacctctgtcccgagctctgagggc
acatctgttatatccatgcttgctatgctgcagaaagcacagatacactatgctttagga
caggtggagcgtggtgtgtgctgcctgatggaggtgataaaggagtctgctcagcatcat
tctaagagctggtacctgctcagggcacgaacactgcaaacagctagtgaatacttgagt
ctggacacagagactttggactcacagctacgtcagagcatcactcagcatggtctgaag
actccagacacggctcaatatgaagggttaaagcttttgtgcagcctggtgatgatgttg
ctgggcaatgggttttacggcgcccctggaccaaacacagacacacactttgtagatcaa
ggagacagtgttgtatttaagtggctgttgctgagtgaggtgctagtgtcctctgaaagg
atggtgaccgtgaggagcagcagtggggctgttcatgaagctaaagctcagtgtctagag
gctctcaaactggccaccaaactgcagacactcagccactgtgctgagctgttggtgttg
aaagcagaactggagttgatgaagggtgcaaatgaagctagtagtttagatctggatcaa
gttagaaacttacttgatctctgcacagattttggccagggacggcaacagaaatctgag
gttaaaataaaaccacgcaaaggtcggccagctgccccttcttcctctggtcacacccct
gaggaagatgatgatctgagtggaatcctcagctctcgcgcccttctcaaggagcctgtg
gagaccatgtctcgattaggaagccaaggagcatctccccctctgaagcccaaacgccag
catgtgctttcgtgtctgacccacgcagactcctgctcctgtccctgctgcagtgagctc
agtgtggctcgagtcagtatccactgggcactattacaggcagacctccagacagaccct
gagcattctcgccgactacgccaatatgccaggaaacgctgccgtagtgttgcagctaag
ctccaaaacagtttggcagcacttatgtcctctaaaaagtcaactggattatgtctgtcg
ctgctgaaggtggaacaaggcaaagtgcatttgggcgctgtgcttcagctccttagtaca
ggagacaaaggaaaggctacagtcctgtgggaggagataggggcaggattggaggtagtg
acgcccaaagaggcactgacaccagagcttggacccatcagagctgctctgctgggggct
aaagctgtggcctgctgtttggcattggccatgaagaaacagtgtgcccctgaagaactg
ttttcttctgtatggggttggaatccaccgaagattaaacccaaaactgaatcaaagcat
cgatccaagagccccgtttctgacacaactcctccagagacaggtgctaaatgccgccat
gacatgaagagtgcatctgcagagcaggaaagcaggaaaaccaaagagtcctctgtagtt
cctaagaaacctaaggacttggtgcccaaaattaacatcacaaaatcttccatggttttc
aaaacacccaaagcaacaaggacatctcggcccaaatctgtctccactagctctggcatt
ggtgacttaagagcctttgacttcactaatgaggtccctgaaatttctgtcaactttaca
cactcattacacccatctgccagccatcgtggaattgcgaagtcaaaaaccggcccaaag
gggtcgttcgaagtgtacaaagattcttctcctgcagaagagaaacctgtgattgtgcca
gctgcgcctaaacgaaccaagcgctctcgcttcaaggtcgagttcagtgatgaaagtgac
actgaagctgcacctgtagtggaaaagtccgaaaaaaagaagaatgcctccatctccaaa
acatctcgcatcctgaaaccagccctgaactccattcctagtgacctagtgaaccccact
gtagaaccagaacctcccagacgcacacggaccactaagaaaagcacagccctctcctct
accagctgcctctctcctgaggaagaaactggcttatcctcccagacacgcacacgcaga
gggcgaccaaaaaagagtcaaagttcagaggccacagaggaacctgagaggatgaggatg
attaaagaggatgatgaggttcttttgaatatcagcctggaggagctcagagggtctgac
acagagataaatgacacgggcagtccagatgctgattgtgaggtcttgaggagagatctg
gctgcagatgttggacgagagtgtttcagtgagcttagaagaaatggatctcacacaacc
ctaccacatgcatctacacccctagctgacctgtcagtagaggcagtccagtcgtacctg
cgttcctcatggctcctcctccaccatttcccacctccctctctttttccccacatctgc
tcactgctcgctcagtcactcggccagacggatcccatcactactgcaatgctacatgca
cagtcgctgggtgtgtccactcgccaccacatgacccgtcatgtggttagccagttcagg
aagctaaagaaatcatgtaatgatgtagcagaaggtcttggtgctctgagtctggaggaa
acgtctggggcaacacagtctcagaaactctctgcgctggagcagatcttttccttcacc
tcctcacacccaacacagttcccacaaacacactgtcagcagttcacgcagcagctgaaa
gatctgccagcaggaataacagtgtgcatgctgtcgctcacgggtgtgtatcctgatgaa
attggcagcactattcttctgacccgactggagcgtggctctaccccaatcactgttcga
atccctactgcagacagaaagcgctctgttgctgtgctgttggaagaaatggatagagtg
ttgaaggggcaaaaggaagtgagcacagtggctgagaaatcgcagtggtgggaaggaaga
aaggctttggatgctcgtgtggagaaaatgttagaagagatggaagaggctttaagggtg
tggcgaactctactcctgcctttgtcctctgaccctgagcttgaagttcaggtgaagtgc
ttccaaaaggcactgaaaggaacaaagatcacgcaggacattcttaagatggttctctca
gcatctccactcctgtccctgccagacctgcagtgcctcgtggaggggatgggtcagcag
gacaaggacttcctgaggcttctgcagggtggtatgactgaactgagtggaagggaggag
ccaaagggacatacagttctcatcttagacaagttcctgcagaggttgccttgggagaac
attgcttgtctgaagtctcgttctgtcactcgcatgccctcattacatgcagtgcttgga
cacggtcatctgaaagagatggattcaagttgtgttttgtcgtgtggcgtgaaccctaag
aaagtttactatgtgcttaacccagatagaaatctgcccgacactgagaatcgctttaaa
gaatggtttactaatgagcgagcgtggcagggggtttgtggaactgctccagacccagac
aaactacaagaggctgtgaccaccaaagacctctacatttacataggacatggcgcagga
gcccgctttctggatgctcagagggttttgaaagggcctgtgcaggcagtagctcttctg
tttggctgcagtagtgctgctctcagtgtacttggccaccaggagggaacaggaatcatt
ctcagctacttgaccgcaggatgcccgttagtgcttggtaacctgtgggacgtgacggat
cgtgatttagatcgtttcacatcggctctgctccaatcctggctctctgctggttctggc
tcctcccttcttcagcatttaacccaatcgcgtaacgccacacatttaaaacatataatt
ggtgctgcgcccattgcatatggtttgcctgcgtatattcactag

DBGET integrated database retrieval system